(data stored in ACNUC8465 zone)

EMBL: CU928166.PE193

CU928166.PE193       Location/Qualifiers
FT   CDS_pept        394777..395400
FT                   /locus_tag="KLTH0B04796g"
FT                   /old_locus_tag="KLTH-ORF15313"
FT                   /product="KLTH0B04796p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP7"
FT                   /protein_id="CAR21558.1"
FT                   /translation="MLRSTASHALRIPSRLVATPAVYSSASRVCALHSSARVPKSLGEK
FT                   VRSTLSDLNKKVGEAAASGIDKAQEASHTVEEKSHTAAEATKHGLEQLNKKTGQAAASG
FT                   IDKAQNMAQEAGEKAQELKKRDLTQEAKGKAQELKDSDLAQEAKDKAQDLKEGAQEKAG
FT                   EAKGKAQELKHEGKGKAQELKHEAKGKAHEGAAKAKETAREYKD"
     atgctaagaa gcaccgcatc gcacgctcta agaatcccct ccagactggt ggccacccca        60
     gccgtgtact cgtccgcttc gcgggtgtgc gcgctgcaca gcagcgcgcg cgtgccaaag       120
     tcgctgggcg agaaggtacg cagcacgctg agcgacctga acaagaaggt cggagaggca       180
     gctgccagcg ggatcgacaa ggcgcaggag gcgtcgcaca cggttgagga aaagagccac       240
     acggctgcag aggccactaa gcacggtctc gagcagctca acaagaagac cggacaggcc       300
     gccgccagcg ggatcgacaa ggcgcagaac atggcacagg aagccggcga gaaggcgcag       360
     gagctgaaga agcgcgacct gacgcaggag gccaagggca aggcgcagga actgaaggac       420
     agcgacttgg cccaggaagc aaaggacaag gcgcaggacc tgaaggaggg cgcgcaagag       480
     aaggccggcg aggccaaggg taaggcccag gagctcaaac acgagggcaa gggcaaggct       540
     caggagctga agcacgaggc caagggtaag gcgcacgagg gtgcggccaa ggccaaggaa       600
     acggcgcgcg agtacaagga ctaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page