(data stored in SCRATCH zone)

EMBL: CU928166.PE194

CU928166.PE194       Location/Qualifiers
FT   CDS_pept        complement(395490..396632)
FT                   /locus_tag="KLTH0B04818g"
FT                   /old_locus_tag="KLTH-ORF15307"
FT                   /product="KLTH0B04818p"
FT                   /note="weakly similar to uniprot|P80667 Saccharomyces
FT                   cerevisiae YLR191W PEX13 Integral peroxisomal membrane
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21559"
FT                   /db_xref="GOA:C5DCP8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP8"
FT                   /protein_id="CAR21559.1"
FT                   /translation="MSTSVKQPRPKPWEAQGGQNTPMDDGAMITAGEAQGTRGEGAKAD
FT                   GNAAPEPPQKPAALGPENGVGARSGLGNAGTFLGSGGPYSSGYGGSLYGGGMGSMYSGG
FT                   YNSMYGGGYGSMYGGGYGSMMGGGYGAGGMYGMNNNGAQTLAESTQATFQLIEGLIGAV
FT                   AGFAQMLEATYMATHNSFFTMVSMAEQISSLKEMVGSFFGIFAAMKMLKRLLYKVTNGR
FT                   AGLAPARAAAGSKSPLVQEFAKFGDASAQAKRRRRMSWKPLLVFVAAVVGFPLLLRKFI
FT                   AKLSEIQQRRLGAGAVGAGAGGTLDPRNLEFARAVYDFTPENPQVEAALRKGDLMAVIS
FT                   KQDPLGNASEWWQVRTKKGDVGYVPSNYVELIRRTRSESS"
     atgtcaactt ctgtcaaaca acctcggcct aagccgtggg aagcgcaggg cggacagaac        60
     acacctatgg acgatggtgc catgataaca gccggtgagg ctcaaggcac gcgtggggag       120
     ggtgcgaagg cagatggaaa cgcagcgccc gagccgcccc agaagcctgc cgcgctggga       180
     cccgaaaacg gcgtcggcgc gcgcagcggc ctcgggaacg ctggaacgtt tctgggaagt       240
     ggagggcctt atagtagtgg gtatggtgga tccctttatg gaggaggaat gggctcgatg       300
     tacagtggcg gatacaattc gatgtacggc ggaggctatg gttcgatgta cggcggtggg       360
     tacgggtcca tgatgggcgg cgggtacggc gcaggcggta tgtacgggat gaacaacaac       420
     ggtgcacaga cgctggccga gtctacgcaa gcgaccttcc agctgatcga gggcctgata       480
     ggcgccgtcg ccggattcgc acagatgctc gaggcgacgt acatggccac acacaactcg       540
     ttcttcacca tggtgtcaat ggcggagcag atctcgtcac tgaaggagat ggtgggatcg       600
     tttttcggaa ttttcgccgc gatgaagatg ctcaagaggc tactctacaa agttacaaac       660
     gggcgcgcgg gcttggcgcc cgcgcgggcc gcggcaggtt cgaagagccc gctggtccag       720
     gagtttgcga aattcgggga cgcgagcgct caggcgaaac ggcgccggcg gatgtcgtgg       780
     aagccgctgc tggtgttcgt ggctgcggtg gtcgggttcc cgctgttgct gcgcaagttc       840
     atcgcgaagc tgtcggagat ccagcagcgg cgtctgggcg caggcgcggt gggcgcgggc       900
     gctggcggta cgctggaccc tcgcaacctg gagtttgcgc gggccgtgta cgacttcacg       960
     ccggagaacc cgcaggtgga ggccgctctg cggaagggcg acctgatggc cgtgatcagc      1020
     aagcaggacc cgctgggcaa cgcgagcgag tggtggcagg ttcgtacgaa gaagggcgac      1080
     gtgggttacg tgccgagcaa ttacgtagag ctgatccggc gcacgcgcag cgagtccagc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page