(data stored in SCRATCH zone)

EMBL: CU928166.PE195

CU928166.PE195       Location/Qualifiers
FT   CDS_pept        complement(397225..398769)
FT                   /locus_tag="KLTH0B04862g"
FT                   /old_locus_tag="KLTH-ORF15300"
FT                   /product="KLTH0B04862p"
FT                   /note="some similarities with uniprot|Q06324 Saccharomyces
FT                   cerevisiae YLR190W MMR1 Phosphorylated protein of the
FT                   mitochondrial outer membrane localizes only to mitochondria
FT                   of the bud interacts with Myo2p to mediate mitochondrial
FT                   distribution to buds mRNA is targeted to the bud via the
FT                   transport system involving She2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21560"
FT                   /db_xref="InterPro:IPR013712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP9"
FT                   /protein_id="CAR21560.1"
FT                   /translation="MNTPPMGAEKLTPKMSPTMLHLDDSLAPLANPSFMYLDESKSNYP
FT                   AMYRTSLSKLTERGRSGRGRTVEAKTPTKLLRSNSPIRAMLNNPPKMLKPEYIGISKLL
FT                   NNNNSSRVGSAVTPSMILTSSKLNFGNTKKASSEEVRQPTQTQEAKKQVVAPPPTPTPV
FT                   PQTEEPALPQATTASQQMPPPSAQPRTQKHPEPAVHSHHGEKVPQPKQRHHSQMLSHKD
FT                   SRGSKHARGLSSTSTAISGSTACELRTEHAAALPTPGSVEEIATKTPGYRFPSTTSTAS
FT                   SSSTFDLKEFPEALNLNFEVPNDKEEFVLATQSKRSSYISSIGSANEDDLNGWFAQYAE
FT                   DRQVSTLSMGDAQKEKALQTEHFSLRVKQLELQIAELRLQNEEMRHNITAHRTIQDRCM
FT                   FEALHDVQREKENTYKEMDRKMKQLEKQINNYRKVIQKLTNSTKTAPVSKPRIPMLDAL
FT                   ALDEISETRSSDGEEDEHVDDATIISELNPDERSASASQSPRKRPAGFNLSLTFEK"
     atgaacactc ctcccatggg cgcagagaaa ctgacgccca agatgtctcc tacaatgctg        60
     catttggatg acagtttggc accccttgca aacccgtcct tcatgtattt agacgaaagc       120
     aagtcaaact atcctgcaat gtaccgcaca tcactctcga agctaaccga acgagggcgc       180
     tcgggccggg gacgaacggt tgaggccaag acgccaacga agctactgcg ctctaattcg       240
     ccgattcgtg cgatgctcaa caatccgcct aagatgctaa aacctgagta cattggcatc       300
     tccaagctct taaataataa caacagctcc cgggtggggt cagcagttac gccttcgatg       360
     atcttgacat cctccaagct gaatttcgga aatacgaaga aggcatcctc tgaagaggta       420
     aggcagccga cgcaaacaca agaagccaaa aagcaagtag tggcgccgcc gccaacacca       480
     acgccagtac cgcaaacaga agagcctgca ttgccacaag ccacaacagc gtcacagcaa       540
     atgccgccgc catccgcgca accaagaaca cagaaacatc ctgagcctgc agtacattcg       600
     catcacggcg aaaaagtacc acagccaaaa caaaggcacc atagccagat gctgtcacac       660
     aaggattccc gcgggagcaa gcacgccaga gggctttcga gcacaagcac ggctataagc       720
     ggttcgactg catgcgaact gcgcaccgaa cacgcagcag ctctgcccac gcccggttcg       780
     gttgaggaaa ttgcaaccaa gacacccggc tacagattcc catccaccac ttccaccgcc       840
     tcctcgagct ccacgttcga tctgaaagag ttcccagagg cgctcaacct aaacttcgaa       900
     gttcccaacg acaaagaaga gtttgttctg gcaacacaga gcaaaagaag cagttatatc       960
     tcgagcattg gctccgccaa cgaggacgat ctaaatggtt ggttcgcaca gtacgcagag      1020
     gatagacaag tttccaccct gagcatgggc gacgcccaga aagaaaaggc gcttcaaacg      1080
     gagcactttt cgctgcgcgt gaagcagctc gagcttcaga tagccgagct gcgcctacaa      1140
     aacgaagaaa tgagacacaa cataacggca caccgtacca tccaggaccg atgcatgttc      1200
     gaagcgctgc acgatgtgca gcgggagaag gagaacactt acaaggagat ggaccgcaag      1260
     atgaagcagc tggagaagca gataaataac tacagaaaag ttatccagaa actaacgaat      1320
     tccacaaaga ctgcaccagt ctcgaaacca cgaattccga tgttggatgc cctggcgctg      1380
     gacgagatat ccgaaacgag gtctagcgat ggcgaggagg acgaacatgt cgatgatgct      1440
     acaataatat cggaactgaa tcctgacgaa cgtagcgcat cggcgtcaca gtcgccacgc      1500
     aaaagacctg cgggttttaa tttaagtttg actttcgaaa agtaa                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page