(data stored in ACNUC8465 zone)

EMBL: CU928166.PE196

CU928166.PE196       Location/Qualifiers
FT   CDS_pept        400193..401914
FT                   /locus_tag="KLTH0B04884g"
FT                   /old_locus_tag="KLTH-ORF15294"
FT                   /product="KLTH0B04884p"
FT                   /note="highly similar to uniprot|P00927 Saccharomyces
FT                   cerevisiae YER086W ILV1 Threonine deaminase catalyzes the
FT                   first step in isoleucine biosynthesis expression is under
FT                   general amino acid control ILV1 locus exhibits highly
FT                   positioned nucleosomes whose organization is independent of
FT                   known ILV1 regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21561"
FT                   /db_xref="GOA:C5DCQ0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ0"
FT                   /protein_id="CAR21561.1"
FT                   /translation="MASKISSQELKMSSTLLTRTRPALVSRFLLRYQSSAVANLQKLHA
FT                   KLNPDELLPDSTPDYVRLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFS
FT                   FKLRGAYNMMAKLSEAQKNQGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQ
FT                   NVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIPPFDHPYVIAGQGTVAMEILRQVH
FT                   NAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLST
FT                   VGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEPSGALAV
FT                   AGLKKYVTQVHPDVDHSKKTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTIPDV
FT                   PGSFKQLQRVIHPRAVTEFSYRYNEHRHSSASDVPKAYIYTSFSVVDREKEIKQVLQQL
FT                   HGLGFDAVDISDNEMAKSHGRYLVGGASKVPNEKIVSFEFPERPGALTKFLDGMSDSWN
FT                   LTLFHYRNHGSDVGKVLAGVSVSAEDNEGFQKFLDDLGYKYQDETNNMVYQKFLKF"
     atggcatcaa agatctcgtc acaagagctc aagatgtctt cgacactgct gactcgcacg        60
     aggcctgccc tcgtctcaag gttcttgcta cgctatcaat ctagcgccgt cgcaaacctt       120
     caaaagttgc atgctaaact caaccctgat gagcttttgc ccgacagcac gccagactat       180
     gtgcggttga tcttgaggtc ctcggtgtac gatgtcatag aagagtcacc aataacccgc       240
     ggtgttggat tatcgtctcg cctcaacact aatgtccagc tcaaaagaga ggacttgctg       300
     ccagttttct cgttcaagct gcgtggagca tacaacatga tggccaagct gtcagaagct       360
     caaaaaaacc agggtgttat agcttgttct gccggtaacc atgcccaggg tgttgctttt       420
     gcatccaggc atctaaacat acccgctatt atcgtcatgc ctgttaacac accttccatc       480
     aagtaccaga atgtctccag acttggaggc caggtggtgc tgtacggtaa cgacttcgat       540
     gaagccaaga ctgaatgcac cagaatctct gaagaaagag ggctgacaaa catccctcct       600
     ttcgaccatc catatgtcat tgcgggacag ggcactgtcg ccatggaaat tttgagacag       660
     gtccacaatg cggcaaagat cggcgcagtt ttcgtgccag ttggcggtgg cggtttagtc       720
     gctggtgttg ctgcttactt gaagagaatt gcaccacaca tcaagatcat cggcgttgag       780
     acttacgact ctgcaactct taagacatcg cttgaagctg gtactcgcac cccattgagc       840
     actgttggaa cttttgctga tggtacttcc gttcgcatga tcggtgaaga gactttccgt       900
     atctgccagg atcttgttga cgatgttatt ttggtgaaca cagacgaaat ctgcgctgca       960
     gtaaaggata tcttcgaaga cactagaagc attgtcgagc catcaggcgc tctagctgtt      1020
     gctggtctca aaaagtacgt tacacaagtg caccctgatg ttgaccactc caagaaaacc      1080
     tatgtgccaa tcctgtcagg tgccaacatg aactttgaca gattgagatt cgtatccgag      1140
     cgtgctgtgc ttggtgaggg taaggaagtc ttcatgcttg tcaccatccc agatgtccca      1200
     ggttctttca agcagctgca gcgtgttatc cacccaagag ctgtcactga attctcctac      1260
     cgttacaacg aacatcgtca cagcagcgca tctgatgtgc ccaaagccta catctacact      1320
     tctttcagcg ttgtggaccg tgagaaggaa atcaagcagg ttttgcagca gcttcatggc      1380
     ctcggatttg atgctgtgga catttccgac aatgagatgg ccaagagtca tggaaggtat      1440
     ctcgttggag gcgcctccaa ggtcccaaac gagaagattg tgtcttttga attcccagag      1500
     agacccggtg ctctaacgaa gtttctggat ggaatgagcg actcctggaa cctcacgctg      1560
     ttccactaca gaaaccatgg ctccgatgtg ggcaaggtct tggctggtgt ttcggtatcg      1620
     gcagaggaca atgaagggtt ccaaaagttt ttggatgacc tgggatacaa gtaccaggac      1680
     gagaccaaca acatggttta ccagaaattc ttgaagtttt aa                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page