(data stored in ACNUC8465 zone)

EMBL: CU928166.PE198

CU928166.PE198       Location/Qualifiers
FT   CDS_pept        complement(403949..404218)
FT                   /locus_tag="KLTH0B04928g"
FT                   /old_locus_tag="Klth0B.mRNA.pd.5.m"
FT                   /product="KLTH0B04928p"
FT                   /note="highly similar to uniprot|P52871 Saccharomyces
FT                   cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
FT                   component involved in protein translocation into the
FT                   endoplasmic reticulum homologous to Sbh1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21563"
FT                   /db_xref="GOA:C5DCQ2"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ2"
FT                   /protein_id="CAR21563.1"
FT                   /translation="MSTPTPPGGQRTLQKRRQAQSVKEKQQKQTPASTRQAGFGGSSNS
FT                   VLKLYTDEANGLRVDPLVVLFLAVGFIFSVVALHVVAKVTGKLF"
     atgtcgactc ctactccccc aggtggacaa cgtacgttgc agaaaagaag acaggcgcag        60
     tccgtcaagg agaagcagca gaaacagacg cccgcgtcga ccagacaggc cgggttcggt       120
     ggctcctcca acagcgtgct gaagttgtac acagatgaag ctaacggttt gcgcgtggac       180
     ccgctggtcg tgttgttctt ggcagtcgga ttcatcttct ccgtggtcgc cctgcacgtt       240
     gtggccaagg tcaccggcaa gctgttctaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page