(data stored in ACNUC8465 zone)

EMBL: CU928166.PE199

CU928166.PE199       Location/Qualifiers
FT   CDS_pept        405537..407279
FT                   /locus_tag="KLTH0B04950g"
FT                   /old_locus_tag="KLTH-ORF15281"
FT                   /product="KLTH0B04950p"
FT                   /note="some similarities with uniprot|P34217 Saccharomyces
FT                   cerevisiae YBL051C PIN4 Protein involved in G2/M phase
FT                   progression and response to DNA damage interacts with
FT                   Rad53p contains an RNA recognition motif a nuclear
FT                   localization signal and several SQ/TQ cluster domains
FT                   hyperphosphorylated in response to DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21564"
FT                   /db_xref="GOA:C5DCQ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034069"
FT                   /db_xref="InterPro:IPR034186"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ3"
FT                   /protein_id="CAR21564.1"
FT                   /translation="MSDMPAATLQEPLMGNSAAMGGSVFAPRSPEDDVIPTAIVIKNIP
FT                   FAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHSLNGKEIG
FT                   GRKLRVEYKKMLPQAERERIEREKREKRGQLEEQHRATSALSLHSLNKSPNVASGPAAA
FT                   AGSNANTNETAGGAAAGSAAASTSGPTQSASQALSNPASSQMFNDFGSSGGANATGGPI
FT                   NSVLSSQPAMSSQPLLSAQNTATSMVLPPALPVGSSERYYAPLPASNNLPLPPQQLDFN
FT                   DPDTLELYSQLLLFKDREKAYHELAYPVGLSASHKRVINVLCSFLGLVEVYDPSFIIIR
FT                   RKVLDHAALQSHLQQEGQLSLMQPLQPSSTGGSGMSRSHSYTSLLQAHATAAAAAVNSV
FT                   GGQSQHIPPPSQSPLLQPTAIHQMESQHQQQQSLLRQQATQTPSSSILQNRIPTGYATK
FT                   HTTPSGMNNPLLRNAGVSPTTGQVQPNTVQRMPSFYSQAPSTPNLSDNRYGSTQNLVPQ
FT                   HTNGSVHSNYSVHSFHDPSAADPQNHAMMYSSVSQLGIGPELEGDLSRSLSGLDLQGKK
FT                   NLWG"
     atgtcagaca tgcccgcagc cacgctacaa gaacccttga tgggcaactc cgccgcgatg        60
     ggcgggtccg tgttcgcccc gagatctccg gaggacgatg tcatccccac ggccatcgtc       120
     atcaaaaaca tcccgttcgc catcaagaag gagcagctgc tcgaggtcat cgccaagatg       180
     gacctacccc tgccctacgc gttcaactac cacttcgaca acggcgtatt ccgcggtctc       240
     gccttcgcca acttcgccac cacggacgag accacacagg tggtccactc gctgaacggc       300
     aaggagatag gcggccgcaa gctgcgtgtc gagtacaaga aaatgctgcc tcaggccgag       360
     cgcgaacgca ttgagcgcga gaagcgtgag aaacgagggc agctcgaaga gcagcatcgc       420
     gccacgtcgg ccctctcgct ccactcgctt aacaagtctc ccaacgtggc aagcggcccc       480
     gcagccgccg ccggcagcaa cgccaacacc aacgagaccg cgggaggcgc ggcggctggc       540
     tcagcggccg ccagcaccag cggtccaacg caaagcgcct cgcaggctct ctcgaaccct       600
     gccagttcgc agatgttcaa cgactttggc agcagcggcg gtgccaatgc cacaggcggc       660
     cctataaaca gtgttctctc atcgcaacct gccatgagtt cccagccgct tctctcggcc       720
     cagaacaccg ccacctcgat ggttctgcca cctgccctgc cagtcggctc ctcagagcgt       780
     tactacgcgc ccctcccggc gtccaacaat ttgcctctgc caccacagca gctggacttc       840
     aacgacccgg acaccctcga gctctactcg cagcttttgc tcttcaagga ccgcgagaag       900
     gcctaccacg agctggcgta cccggtggga ctctccgctt cccacaaacg cgtcatcaac       960
     gttttgtgct ccttcctggg tttggtggag gtttacgacc ctagcttcat cattatccgc      1020
     cgcaaagttc tcgaccatgc cgcgctgcag tcacatctgc agcaggaagg tcagttgtcg      1080
     ttgatgcagc cgctgcagcc tagttccact ggcggctctg gcatgtcacg ctcgcattcc      1140
     tacacttcgt tgttgcaagc ccatgccacg gccgcggctg cggctgtgaa cagcgttggc      1200
     ggccagtccc aacacattcc accaccttct cagtccccac ttctgcagcc cacagcgatt      1260
     caccagatgg agtctcagca ccagcagcaa cagtcgcttc tgagacagca agccacccag      1320
     acgccatcgt cctccatcct ccagaataga atccccaccg gttatgccac aaagcatacc      1380
     acgccttctg gcatgaacaa cccgctgctg agaaacgccg gggtttcgcc cacgacgggc      1440
     caggtccaac ctaacaccgt gcagcggatg ccctccttct actcccaggc tccttccacc      1500
     cccaacttga gcgacaatcg ctacggcagc acccaaaacc ttgttccaca gcacaccaac      1560
     ggcagcgtgc actccaatta ctcagtgcac tccttccatg acccctctgc cgcggacccc      1620
     cagaaccacg ccatgatgta cagttccgtg tctcaattgg gaattgggcc ggagttggag      1680
     ggcgacctca gccgctccct cagtggactt gatctacagg gaaagaaaaa tctctgggga      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page