(data stored in ACNUC8465 zone)

EMBL: CU928166.PE200

CU928166.PE200       Location/Qualifiers
FT   CDS_pept        408153..409235
FT                   /locus_tag="KLTH0B04972g"
FT                   /old_locus_tag="KLTH-ORF15272"
FT                   /product="KLTH0B04972p"
FT                   /note="highly similar to uniprot|Q04894 Saccharomyces
FT                   cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
FT                   dehydrogenase family member with broad substrate
FT                   specificity may be involved in fusel alcohol synthesis or
FT                   in aldehyde tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21565"
FT                   /db_xref="GOA:C5DCQ4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ4"
FT                   /protein_id="CAR21565.1"
FT                   /translation="MSYPEKFQGIAVQDHNDWTHPKKISYEPKKFDDYDVDVEIEACGI
FT                   CGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGVGAQVSSCLDCD
FT                   RCNSDFEPYCAEFITTYSQPYPDGYVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLC
FT                   GGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIFAKALGAEVYAISRSSAKKEDAMKL
FT                   GADHFIATKEEPDWEKKYASTLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKET
FT                   EELNLKPFQLSGITIGNSQLGSRKELIQLLQLVADKDLKIWVETLPISEESVHDAFVRM
FT                   EKGDVRYRFTLTDFDKEFRN"
     atgtcatatc ccgaaaagtt ccaaggtatt gccgttcagg accataatga ctggacacat        60
     cccaagaaga tctcttacga gcctaaaaaa tttgacgact acgacgttga tgtggaaatc       120
     gaggcctgtg gtatctgcgg tagtgatacc cactgcgcca gcgggaactg gggccctaag       180
     tcgctgccgc ttgtcgttgg ccatgaagtg attggccgcg tggttcgcgt tggtcccaag       240
     tgccacaccg gtgtaaaggt cggtgaccgc gtgggtgtcg gtgcgcaggt gtcttcgtgc       300
     ttggactgcg accgctgcaa cagcgatttt gagccctact gcgccgaatt catcacaact       360
     tacagtcagc cctacccaga tggctacgtt tcgcagggtg gttatgcgtc tcacattcgc       420
     gcgcatgagc atttcgtgat tcctatccca gagaaaatcc caacgcacct agctgccccg       480
     cttctttgcg gcggtatcac ggtattctcg cctctaatta acaacgattg cggaccaaac       540
     aagaaagtcg gaatcgtggg tatcggcggt attggccaca tgggtctgat cttcgccaaa       600
     gctctcggag ctgaggtcta tgcaatttcc agatcgtctg ctaaaaaaga agacgccatg       660
     aagctaggcg ctgaccactt catcgctacg aaggaggagc ctgactggga aaagaagtac       720
     gccagcactc tggacctggt tattgtttgt gccagctctc tgactgaaat taacctggag       780
     caactcatca aaactatgag aatcaaaggt agaatcattt ccatttgcgt gccaaaggag       840
     actgaagagc ttaacctcaa gcccttccag ctcagtggta tcacgatcgg aaacagtcag       900
     ttgggctctc gtaaggagtt gattcagttg ctgcaattgg ttgcagacaa ggacttaaaa       960
     atctgggttg agacattgcc tatcagcgaa gaatctgttc acgacgcctt tgtgagaatg      1020
     gaaaagggcg atgttaggta caggtttacg ttaaccgact ttgataagga gttccgcaac      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page