(data stored in ACNUC8465 zone)

EMBL: CU928166.PE203

CU928166.PE203       Location/Qualifiers
FT   CDS_pept        join(415138..415176,415852..416868)
FT                   /locus_tag="KLTH0B05038g"
FT                   /old_locus_tag="Klth0B.mRNA.296.p"
FT                   /product="KLTH0B05038p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21568"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ7"
FT                   /protein_id="CAR21568.1"
FT                   /translation="MPLSMIEALSCSALTGFCKSDFDRVVEALKIPSYIGAYSFDAFEC
FT                   FFIFIARLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASPCLSVTNASWLADRL
FT                   ANIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLECVAYSGHKKTHTLKYQAVT
FT                   TPDGICIDLAGPFAGSQHDSFLFTNSGLYRRLKPALKVGGIQYRIFGDPAYRSSDLLTV
FT                   GYKGQNLTNGQKEYNTILSGSRVSIEWFFGEVKNNFQIFNILGRLKVGGVRFCGAYFTI
FT                   AVFLTNLKHCLEGSQGSKYFNISPPRFEEYMNGLKFPQYFDGFLIDVNGTSSFFSKQYE
FT                   HLSFDRLGNIL"
     atgccgctca gcatgatcga ggctctctca tgtagcgccc tgacaggttt ttgtaagtct        60
     gatttcgatc gtgttgttga ggcactgaag ataccttcct atattggggc atattcattt       120
     gatgcttttg aatgcttctt cattttcatt gctagattga agagtggttg cacttatacc       180
     gtcctgacta gcctttgtgg aagggaagct tcaacaattt caagaatcat aacatttgtg       240
     acgtgctacc tgtttcatat tgcaagtcca tgtctgtctg ttactaacgc atcatggctt       300
     gctgatcgtc ttgccaacat cgaccaaagc cttttaagtt caagcaggtc aatctctaac       360
     agtagaatcg tgggatttat cgatggcacg cacgttaaga tagcccggcc gcacggaaac       420
     gcgagactag aatgtgtggc ttacagcgga cacaagaaaa cacataccct aaagtatcag       480
     gcagtaacca ccccagatgg tatatgtata gacctggcgg ggccttttgc cggcagccag       540
     catgattcct ttctttttac aaatagtggt ctgtaccgta gactaaagcc agcactaaag       600
     gtcggtggta ttcaatatag gatatttggg gaccccgcct accgaagttc agacttgctg       660
     acggtcgggt ataagggaca gaacttaaca aatgggcaaa aagagtacaa tacgatttta       720
     tctggctcgc gcgtatcaat cgagtggttt ttcggcgaag tcaaaaacaa tttccaaatc       780
     tttaatattc tgggaagact gaaagtagga ggtgtgagat tttgtggtgc ttatttcact       840
     attgctgtat tcctaacaaa ccttaagcat tgcttagaag gatcccaagg ttctaagtat       900
     tttaatattt ctccaccacg ctttgaagag tacatgaatg gactcaagtt cccccaatat       960
     ttcgatggct tccttataga cgtcaatgga actagttctt ttttctcaaa acaatacgaa      1020
     cacctgagtt ttgatagact cggaaatata ttataa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page