(data stored in ACNUC8465 zone)

EMBL: CU928166.PE205

CU928166.PE205       Location/Qualifiers
FT   CDS_pept        complement(419442..420332)
FT                   /locus_tag="KLTH0B05082g"
FT                   /old_locus_tag="KLTH-ORF15246"
FT                   /product="KLTH0B05082p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21570"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ9"
FT                   /protein_id="CAR21570.1"
FT                   /translation="MALKVGFIPEHFATPLCFAKTVGFFEDQGVEAELIPYPSGSGHLI
FT                   QSLNAGELDIAIGLTEAFVRGIADTEPGQKPQYQIAGTYVKSPLEWCVSTGANRDDLQD
FT                   LKALDGRRIGVSRIGSGSHVMSYVMALQLDFTKPFADFPVLDNFDNLRAAVNSGDADAF
FT                   MWEYYTSKKYLDSGEIKMLGHVESPWPSWVVVKRVDLDLGVFGRFVFAINSGIDYFNKN
FT                   PDEAVRFITENFGYSEEDAASWFKTVKFHDNCGDINDLHGVVTGTLHILGTAGVLQNKD
FT                   EVVIEENLRVGTLTG"
     atggctctga aagttggatt tatcccagaa catttcgcta ctccattgtg ctttgcaaag        60
     acagtgggat tcttcgaaga ccagggcgtg gaagcggagc tgatcccata cccaagcggg       120
     tccggccacc tgatccagtc gctgaacgca ggcgagctgg acatcgcaat tggactcact       180
     gaggcgtttg tgcgcggcat tgccgacacc gagcccggcc agaagcccca gtaccagatc       240
     gcgggcacat acgtgaaatc gccgctcgag tggtgcgtgt ccacaggcgc caaccgcgac       300
     gacctgcagg acctcaaggc attggatggc cgccggatcg gtgtgtccag aatcgggagc       360
     ggatcgcacg tcatgagcta cgtgatggcg ctgcagctgg acttcaccaa gcccttcgca       420
     gacttccccg tgctggacaa cttcgacaac ctgcgcgcgg ccgtcaactc gggcgacgcg       480
     gacgcgttca tgtgggagta ctacacatcg aagaagtacc tggactccgg cgagatcaag       540
     atgctgggtc acgtggagtc gccttggccc tcctgggtcg tggtgaagcg cgtggacctg       600
     gacctgggcg tttttggcag gtttgtgttc gctatcaaca gcggtatcga ctacttcaac       660
     aagaaccctg acgaggctgt gcgcttcatc actgagaact tcgggtactc ggaggaggac       720
     gcggcgtcgt ggttcaaaac cgtcaagttc cacgacaact gcggcgacat caacgacctg       780
     cacggcgttg tgacgggcac actgcacatc ctgggcaccg ctggcgttct gcagaataag       840
     gacgaggtcg tgatcgagga gaacctgcgc gtgggcaccc tgaccggcta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page