(data stored in ACNUC8465 zone)

EMBL: CU928166.PE207

CU928166.PE207       Location/Qualifiers
FT   CDS_pept        complement(423735..425168)
FT                   /locus_tag="KLTH0B05126g"
FT                   /old_locus_tag="KLTH-ORF15236"
FT                   /product="KLTH0B05126p"
FT                   /note="similar to uniprot|P53923 Saccharomyces cerevisiae
FT                   YNL119W NCS2 Protein with a role in urmylation and in
FT                   invasive and pseudohyphal growth inhibits replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive- strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21572"
FT                   /db_xref="GOA:C5DCR1"
FT                   /db_xref="InterPro:IPR019407"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR1"
FT                   /protein_id="CAR21572.1"
FT                   /translation="MGINQLCKRCKTAEAAVVSRKEPFCIACFRKFVSLKQRKQMMSDQ
FT                   YFQDIFKVMYPDKKKTAEEAERLNQGSRILVPLSFGSSSIVMLDVLNDTLTEQREMHRG
FT                   KTGFRIDVLVCYLKDDLEELKRKAEALMTVKLRDNKNSVKVHLVDIESSMNSPDFTRIH
FT                   LQDSTYMVRNASVSANEAQSVKELLSSCSNRSAREDLLNIIKTAIIKRFGVQGGYKAIL
FT                   WGHSTTRLADEIMSLVVKGRASQIANALNDSEEDFEYGEPLRNLHPMRDILLSEIDAYC
FT                   FVSDLTQYLHKYKPQDTLLVNKIPVAPDAQPPRAKLTKNMTINELARQYFDGIEGSYSN
FT                   VISTVVRTGAKLDDPENSLKSKVRCGICNNTVFCDGSHWLRNITVTSSHPIEDAEEEAM
FT                   FRAWSASEQGKVRGEYLKLTSEMEISGHEFPVCYGCILTLGEVKHKSLIWPSSQSNSVE
FT                   SVIEDFIISDESDSEHEGH"
     atgggtatta atcaactctg taagcggtgc aaaactgcag aggcagcagt tgtgtcaagg        60
     aaagagcctt tctgtatcgc atgtttccgc aaattcgtgt ctttgaagca gcggaaacaa       120
     atgatgtcag accagtactt ccaggacata ttcaaagtca tgtatccgga caagaagaaa       180
     acagcagagg aagctgagag gctcaatcaa ggatcgagga tattggtacc actgtcgttc       240
     ggttcatctt cgattgtaat gcttgatgtc ctaaatgata ctttgacaga gcagagagag       300
     atgcatcgtg gtaagacggg cttccggatt gatgtgctag tttgctatct caaagatgat       360
     ctagaagagc ttaaaagaaa agcggaggct ttgatgaccg taaaactgcg agacaacaaa       420
     aatagcgtca aagttcatct tgttgacata gaatcttcca tgaattctcc agatttcact       480
     cgcattcact tacaagactc aacttacatg gtgcgaaatg cctctgtatc tgctaatgaa       540
     gcacagtcag tgaaagagct actcagctcg tgctcaaacc gttcagcgcg tgaggaccta       600
     ctcaatatca tcaagacggc tattataaag cgttttggag ttcagggcgg ttataaagct       660
     attttgtggg ggcactcaac gactagactt gcagatgaaa tcatgtcctt ggttgttaag       720
     ggacgcgcct ctcaaattgc taatgcactc aacgattccg aagaggactt cgaatatggg       780
     gaacctttga gaaatcttca tcccatgaga gatattcttc tgtccgaaat cgatgcatat       840
     tgctttgttt cagatcttac gcagtatctt cacaaataca aaccccaaga tacgctcttg       900
     gtcaacaaaa taccggttgc cccggatgct caacctccaa gagcaaaatt aacaaagaac       960
     atgacaatta atgagctcgc ccgccaatat tttgatggta tcgaaggaag ctattctaat      1020
     gttatctcta cggttgtaag gacaggcgcc aaacttgacg accccgaaaa cagcctgaag      1080
     agtaaagtaa gatgcggaat ttgcaacaat acagttttct gtgatggatc acattggctc      1140
     aggaacatta cggttaccag ttctcatcca atagaagacg cagaggaaga agcaatgttt      1200
     agagcatgga gtgcttctga gcaaggtaaa gtgagaggtg aatacttgaa gttaacatca      1260
     gaaatggaaa tttcaggcca tgagtttcca gtatgctatg gttgtattct taccctaggc      1320
     gaggttaaac acaagagttt aatctggccc agcagtcaat caaacagcgt cgaaagcgtt      1380
     attgaagatt ttattatatc agacgaaagt gacagcgagc acgaagggca ttag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page