(data stored in ACNUC8465 zone)

EMBL: CU928166.PE208

CU928166.PE208       Location/Qualifiers
FT   CDS_pept        426037..426372
FT                   /locus_tag="KLTH0B05148g"
FT                   /old_locus_tag="KLTH-ORF15234"
FT                   /product="KLTH0B05148p"
FT                   /note="similar to uniprot|P38824 Saccharomyces cerevisiae
FT                   YHR116W COX23 Mitochondrial intermembrane space protein
FT                   that functions in mitochondrial copper homeostasis
FT                   essential for functional cytochrome oxidase expression
FT                   homologous to Cox17p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05148g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21573"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR2"
FT                   /protein_id="CAR21573.1"
FT                   /translation="MEKEPKTAPAENADPQLQVDKTKVDYAPKNTESGSFKFYPDNPES
FT                   SFNKYRFAAKDASQFYDPCQESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQARR
FT                   RNRSQWE"
     atggaaaaag aacccaagac tgctcctgct gaaaatgcgg atccacaact acaggttgac        60
     aagacaaagg tcgattatgc gcctaaaaac acagaatctg gtagcttcaa attctatccc       120
     gacaacccag agtccagctt caacaagtac agattcgcgg ccaaagatgc aagccagttt       180
     tacgacccat gccaagaatc ttccaagatg agcatgaagt gtttggagct taataattac       240
     gaccggtcca tgtgccaaga gtacttcgac gcctaccgcg agtgcaagaa acagtggcta       300
     caagcccgaa ggagaaatag gtctcaatgg gagtaa                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page