(data stored in SCRATCH zone)

EMBL: CU928166.PE209

CU928166.PE209       Location/Qualifiers
FT   CDS_pept        427608..429389
FT                   /locus_tag="KLTH0B05170g"
FT                   /old_locus_tag="KLTH-ORF15233"
FT                   /product="KLTH0B05170p"
FT                   /note="similar to uniprot|P07213 Saccharomyces cerevisiae
FT                   YNL121C TOM70 Translocase of Outer Mitochondrial membrane
FT                   70 kDa mitochondrial specialized import receptor of the
FT                   outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21574"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR3"
FT                   /protein_id="CAR21574.1"
FT                   /translation="MSSDNSFGQFVARNKTAIVASVAAGATAVGAYYYYQQLQRQPANK
FT                   KEPESESKSSKKKKKTKKKAPGPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNE
FT                   FFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSK
FT                   CLLRRASANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQ
FT                   QEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSF
FT                   AKARDAFKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPN
FT                   TYIYMALIMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKA
FT                   KELSESNIFPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLA
FT                   GARKQYDIAAKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRS
FT                   EQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVV
FT                   SAKIEETLAAYRAQGMI"
     atgtcttctg ataattcctt tggccaattc gttgctagaa acaagacggc gatcgtagca        60
     tcggttgctg ctggtgctac tgcagttggg gcttattact actaccagca gctgcaaagg       120
     cagcctgcta acaagaagga gcctgaaagc gaatctaagt caagcaaaaa gaagaaaaag       180
     acaaaaaaga aggctcccgg cccaagctac ccagtcaatg agaaagggga gccagatcta       240
     agcaatctgg ctgaactgag tgacgaacag aaggacaaat acgctatggg cttgaaagat       300
     aaaggaaacg aatttttcaa gaacaagaaa tatgatgaag ctatccagta ctacagctgg       360
     gccattgagg tcaaagaaga ccctgttttc tactccaata gatctgcatg ctacgtttcg       420
     ttgggtcaac aggaaaaggt cgttgaggac actacagcag ccttgaagtt gaagccagac       480
     tactctaagt gtttgcttcg cagagcatcc gcaaacgaga gtttgggcaa ctttgctgat       540
     gccatgttcg acttatctgc agtgagctta tacggggact tcagtggagc ttcaattgaa       600
     ccactgctgg aaagaaacat gaacaagcag tctatgttgg ttttgaaaga aaagttagag       660
     aagcagcaag aatacaagct gccttccaat acttcattag cttctttctt cggcattttt       720
     cagcctgaga ccactttcga gaactacgac gacaactccg aggccgacaa gtacttgcta       780
     gaaggcttaa ccaatcttta caaaagaaca gctgacggct acgagactgc agacttatct       840
     tttgctaagg caagagatgc ttttaaagtc ttactggagc agaaccctga agatgctgac       900
     ctgaagagga aggctgctat tgctttggaa cacgtcggta tcttcaaatt tttgaaaaat       960
     gatcctatct ctgctcacga agacttgaag aaggctgtcg agtatttccc tagacctaac      1020
     acgtacattt acatggcttt gatcatggcc gacaagggtc aagccactga atattttgac      1080
     aactttgaga aagccctgaa actcgaccct tcatgcgctg ccgtttacta ccatcgtggc      1140
     caaatgtact ttatcactca acagtttgag caggccggta aagactttga gaaggctaag      1200
     gaattgagcg agtccaatat tttcccttac atccaattgg cctgcttgac ataccgtgag      1260
     ggcaaatttg atgacagcga gaccctattt agtgaagcta gaagaaaatt cccaactgct      1320
     cctgaagttc ctaactttta tgctgaaact ctttccgaca agggcgacct agcaggcgct      1380
     agaaagcaat acgacattgc cgcaaagcta gaagatgcac tcgatggtat ccatgtcggt      1440
     gtttccccat tgattggcaa ggccacattg ttatccaggg agccaagcgt tgaaaacttt      1500
     gttgaggcaa ctcagttgtt cgaaaaggca tgccagaacg acccaaggtc tgaacaggcc      1560
     aagattggtc tagcccaatt gaagctccag caagaggaca tcgatgaggc tatcgctctg      1620
     ttcgaagaag ctgccgatct tgcccggagt ttcgacgaaa agctacaagc aacaactttt      1680
     gcggaagcca ctaagatcca aaagaagatc agggcagacc cagttgtgag tgctaaaatc      1740
     gaagagactc ttgctgctta tcgtgcacaa ggtatgattt aa                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page