(data stored in ACNUC8465 zone)

EMBL: CU928166.PE210

CU928166.PE210       Location/Qualifiers
FT   CDS_pept        complement(429511..429930)
FT                   /locus_tag="KLTH0B05192g"
FT                   /old_locus_tag="KLTH-ORF15231"
FT                   /product="KLTH0B05192p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR4"
FT                   /protein_id="CAR21575.1"
FT                   /translation="MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVH
FT                   EGNNNPSSARYGFDSPYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASA
FT                   EDDFFHLQKDIGVRERSFKKPRGYACKNCCMYSHI"
     atgagctttg aattacagat tttaaacgat gttctggatt gggctcgagc acctggtgga        60
     ccagctgggg attacattca tccttcccat gtaagtctct ggtcgtatcc tcgagaaaag       120
     gcgtttcagg ttcacgaagg aaataacaac ccatctagtg cgcgctacgg ctttgattcg       180
     ccgtatggag gacttgtgac acttgaaagc ctttacaaag agagagttga cagctctggc       240
     aaaaactaca aaatcgaaag tggcacaagc gttgaaaatt tcacaaggaa gagaaagttc       300
     gaagccagcg cggaggacga tttctttcat ctgcaaaaag atattggcgt gagagagaga       360
     agtttcaaga aaccccgggg atatgcttgc aaaaattgtt gtatgtacag tcacatatag       420
//

If you have problems or comments...

PBIL Back to PBIL home page