(data stored in ACNUC8465 zone)

EMBL: CU928166.PE212

CU928166.PE212       Location/Qualifiers
FT   CDS_pept        complement(430626..433568)
FT                   /locus_tag="KLTH0B05236g"
FT                   /old_locus_tag="KLTH-ORF15228"
FT                   /product="KLTH0B05236p"
FT                   /note="highly similar to uniprot|P53920 Saccharomyces
FT                   cerevisiae YNL123W shows protein sequence similarity to the
FT                   mammalian Omi/HtrA2 family of serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21577"
FT                   /db_xref="GOA:C5DCR6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR6"
FT                   /protein_id="CAR21577.1"
FT                   /translation="MSLNAKRTHSELSDSECNGRTKLQAANGGHFDSSDEEVSFVEEEI
FT                   VEEPINNAQWQTTISKVVSSVVSIHFSQVAPFDCDSALVSEATGFVVDSELGIILTNRH
FT                   VVGAGPFVGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPKNIKYMQVCALELKPSLAKV
FT                   GSEIRVIGNDAGEKLSILAGFISRIDRNAPDYGELTYNDFNTEYIQAAASASGGSSGSP
FT                   VVNIDGHAVALQAGGSTEASTDFFLPVNRILRALNCIRAKKAVTRGTIQTQWILRPYDE
FT                   CRRLGLTPDREADARKQFPDRIGLLVAETVLREGPGDNKIKEGDTLISINGELIASFIQ
FT                   VDDILDRSVGQTIELLIQRGGKDIKVSCEVGDLHAITPSSYLEVCGATFNELSYQMARF
FT                   YAIPVRGVFLSSASGSFNFDSKEKVGWIVDAIDNQETPTLETFIEVMKKVPDRKRVTVR
FT                   YHHLTDQHSPHVASVYIDRHWCSEFRIYERNDTTGIWDYKNVADPLPPLPEVSHEAKFI
FT                   DLSIDNKQLAKLSRSLVMVSSISPIPLDSLSAEPRKASGLVVDANQGYVVVSRRVIPHD
FT                   CLDVFVTIADSVILPAEVTFLHPTQNYAVVKYDPALVLAPVETPKLSFARMKRGDKAHF
FT                   IGYTHNNRLVSSDTKVTDISSLSVPSNLIPRYRATNLEAIGIDCNVSSRCNSGILADDD
FT                   GTVRALWLSFLGEIQDGKEKVYLMGLDMADLKSVIDLLKEGKKPRINIVDAGFGSISVA
FT                   QARIRGVPEEWISKMEQESENRLQFMNVTRVSFTNEKDKLYPGDVILCVGGKLVKEMRD
FT                   LDGIVTSGEGANEEQVLEFKLVRNGKIVDLSVKTREINETSHFAIFAGCILQAPHHAVL
FT                   QAMMDIPSSVYCTFRGQSSPATQYGIAATNFITHINEIETPDLDTFVKVVKTIPDNTYC
FT                   KIRLVTFDNVPFAISLKTNYHYFPTAELKKDPSSGKWIENELNKTDARSD"
     atgagtttaa atgctaagag aacgcactct gagcttagtg actctgagtg caatggccgc        60
     actaaactac aagccgccaa cggagggcac ttcgattcct ctgatgagga agtttcgttt       120
     gtagaggaag aaatcgttga ggagccaatc aacaatgccc agtggcaaac caccatatcc       180
     aaggttgtga gctctgtggt gtccatacat ttttcgcagg tggctccgtt cgactgcgac       240
     tcggccttgg tttccgaagc tactgggttt gttgtggact ctgaactagg cataattctc       300
     accaacaggc atgttgttgg tgctggtcca tttgtcggtt atgccgtctt tgacaaccac       360
     gaagaatgtg acgtcattcc catttacaga gacccagttc atgacttcgg ctttttgaag       420
     tttgacccaa aaaatatcaa atatatgcaa gtttgcgcac ttgagcttaa gccctcgctc       480
     gcgaaagtcg gatctgagat cagggtcatt ggtaatgacg caggcgaaaa gcttagtatt       540
     ttggcaggat ttatcagcag aattgacagg aacgccccag attatggtga actaacatac       600
     aatgacttca acacagaata catccaggcc gcggcatcag cttcaggagg gtcgtctggt       660
     tcaccggtcg ttaacattga tggacatgcg gttgcccttc aagccggtgg ttcgacagaa       720
     gcttcaacag actttttttt acctgtaaac agaatcctga gggcacttaa ctgcatcaga       780
     gccaaaaaag ccgttaccag aggcactatt cagactcagt ggattttaag gccctatgat       840
     gaatgtcgaa gactaggact aacaccggat cgtgaagcgg atgcgcgcaa acagttccca       900
     gatcgcatcg gcttgctagt ggctgaaaca gtgctacgag aaggtccggg tgacaataag       960
     atcaaagaag gagatacgct tatttccatc aatggtgagt tgatagcttc tttcatacaa      1020
     gttgacgata tattggatag aagtgtaggg caaacgattg agctgctgat ccaacgtggg      1080
     ggcaaagaca ttaaggtgag ttgcgaagtt ggtgacctac acgccataac gccatcttcc      1140
     tatttagagg tttgcggtgc cactttcaat gaactttctt accagatggc caggttttat      1200
     gccatccctg ttcgtggtgt gttcttgagt agcgcgtcag gctctttcaa tttcgactca      1260
     aaggagaaag ttggctggat cgttgacgct attgacaacc aagaaactcc aacgttagaa      1320
     acttttattg aagtaatgaa gaaagtgccc gaccggaagc gtgtaacggt gaggtatcac      1380
     catttaacgg accaacactc tccccatgtt gccagtgttt acatcgaccg ccattggtgt      1440
     agtgaattca gaatttatga aagaaatgac acgacgggta tttgggacta caaaaacgtt      1500
     gccgaccctt tgcctcctct tcccgaagtt tctcacgagg ccaaattcat tgacctttcg      1560
     atagacaata aacaattagc caagctctcc agaagtcttg tgatggttag ttcgatttcc      1620
     cctatacctc ttgattcact ctcagcagag cctcgaaaag catcaggact tgttgtcgat      1680
     gctaaccaag gatatgttgt tgtctcgcgc cgtgttatac ctcacgactg cctggacgtg      1740
     ttcgtcacaa ttgcagactc ggtgatcctt cctgctgagg taacattcct acatcctact      1800
     cagaactacg ctgttgtaaa gtatgaccct gctttagttt tagctcctgt tgaaactcca      1860
     aagctgtctt ttgccagaat gaagaggggc gacaaggctc actttattgg atacacccat      1920
     aacaacaggc ttgtgtcctc tgatacaaag gtgacggaca tttcttcttt gagtgtgcca      1980
     agcaacttaa tccctaggta cagagccacg aatttagaag ccattggtat cgactgcaac      2040
     gtaagctcga gatgcaactc tggaatttta gcagatgatg atgggacggt aagggcgtta      2100
     tggttatcat tccttggtga gattcaggac gggaaagaaa aggtatactt gatgggcctg      2160
     gatatggcgg atttgaagtc tgtaatcgat ttactgaaag agggcaagaa acctagaatc      2220
     aatatcgtcg atgcagggtt cggctcaatt tctgttgcac aagccagaat ccgcggagtc      2280
     cctgaagagt ggatttctaa aatggagcaa gagtctgaaa acagacttca gttcatgaat      2340
     gttacaagag tgtccttcac taacgagaaa gacaagttgt atcctggcga cgtaattttg      2400
     tgtgttggag gaaaacttgt taaagaaatg agggacctgg atggaatcgt aacctcgggt      2460
     gaaggagcta acgaagagca agtgcttgag tttaagctcg tgagaaatgg gaagatcgtg      2520
     gatctctccg tgaaaactcg tgaaatcaat gagacgtcgc acttcgcaat ttttgctggc      2580
     tgcattttgc aggcaccaca tcacgcggtc ttgcaagcta tgatggatat tcctagcagt      2640
     gtttattgca ctttcagagg acaatcatca cctgcaacac agtacggcat agcagccact      2700
     aattttatca cccacatcaa cgaaattgag acgcctgacc tcgacacttt tgtgaaggtt      2760
     gtgaaaacca ttccagacaa cacatactgc aaaattcgac tggtaacgtt tgacaacgtc      2820
     ccgtttgcaa tttctctgaa aaccaactat cactacttcc ctactgctga gctgaagaaa      2880
     gatccatctt ccggcaaatg gattgaaaac gaactcaaca agacagatgc gcgttcggat      2940
     taa                                                                    2943
//

If you have problems or comments...

PBIL Back to PBIL home page