(data stored in ACNUC8465 zone)

EMBL: CU928166.PE213

CU928166.PE213       Location/Qualifiers
FT   CDS_pept        complement(433847..435127)
FT                   /locus_tag="KLTH0B05258g"
FT                   /old_locus_tag="KLTH-ORF15224"
FT                   /product="KLTH0B05258p"
FT                   /note="similar to uniprot|P38826 Saccharomyces cerevisiae
FT                   YHR118C ORC6 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing
FT                   may be phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05258g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21578"
FT                   /db_xref="GOA:C5DCR7"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR7"
FT                   /protein_id="CAR21578.1"
FT                   /translation="MSTQQVRRCVCDILSIEFDDPKNDWSQGRLKKLQTTTSTLYNVSL
FT                   SKVMLKQHEETARGHLCAFIAAEKLSEKYEPDLRYRRDKIPLEPRQATKLLDILKSSIL
FT                   TSSPVKSIGWSPSPVKQRSPVKNGGRFTAMDPKEMRKQLFGTPTKANLPPKALENQQTA
FT                   SPEPATEDEANKIRTTRRKLTFEVEDAEDERDLTLASRKVNSASSGEGEVREGTRYAEV
FT                   ENSSMPVTPRKRSASASAKTPSPKKRRIPDRGDAPNSARACLLYKKYYKMTAAEIVELC
FT                   NHFEIPSDLAYRILDQFFEHATYLVFPFQLVCGLILNCCQVIFNEKRRKDPRVNEYLYQ
FT                   KMSLLMKTNDVTEIKESMRIVRELIDGEKWYRNLKVQYDYFDGVVYEEAIAIRLGNMLQ
FT                   RATNIATDEQFEIWKHNIITDISLRDG"
     atgtctacgc agcaggtgag gagatgtgtg tgtgacattt tgagtattga gtttgatgat        60
     ccaaagaacg attggtctca aggtcgactg aagaagttgc aaactacaac ttcaacacta       120
     tacaatgtct cactatcaaa ggtgatgcta aagcaacatg aggaaactgc cagaggacat       180
     ctttgtgcgt tcattgctgc cgagaaactc tcagaaaagt atgagcctga cctgcgatac       240
     agaagagaca aaatcccgct ggagccgcgg caggcaacca agcttcttga tattcttaaa       300
     agttcgattt tgacgagctc gccagtcaaa agcatcgggt ggtcgccaag tcctgtgaaa       360
     caaaggagcc ctgtgaaaaa tggaggccgt ttcacggcca tggaccccaa agagatgaga       420
     aaacaactat tcggtacccc cactaaagca aacttgccgc caaaagcatt agaaaatcaa       480
     caaacagcgt ctccggagcc agcaactgag gacgaagcaa acaaaatacg aactactcga       540
     agaaagctga cttttgaggt tgaagacgca gaagatgaaa gagatctcac tctggcttca       600
     agaaaggtta actcagctag tagcggagaa ggtgaggtta gagagggtac acggtatgct       660
     gaagtggaga attcaagtat gcctgtaact cctcgcaaga gaagtgcgtc agctagcgca       720
     aaaaccccat ctccaaagaa aaggcggatc ccggatcgtg gtgatgcccc aaacagtgca       780
     cgcgcatgtc tcctttacaa aaagtactac aaaatgactg ccgccgagat cgttgagttg       840
     tgtaaccatt tcgaaattcc aagcgaccta gcatatcgca ttcttgatca attctttgaa       900
     cacgcaactt acctagtgtt tccatttcag ctggtctgtg gtctgatcct gaattgttgc       960
     caagtcattt tcaatgagaa aagacgaaaa gatccaagag tgaatgagta cctataccag      1020
     aaaatgtcat tgttaatgaa aaccaacgac gttacggaaa taaaggaatc aatgcgaatt      1080
     gtgcgtgaac tcattgatgg cgaaaagtgg tatcgcaatc tcaaagttca atatgactac      1140
     ttcgatgggg ttgtttatga ggaagccata gcgataagac ttggcaacat gcttcagcgc      1200
     gctaccaaca tagcgactga cgagcaattt gaaatttgga agcacaacat aataactgac      1260
     atttcactaa gagacggata g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page