(data stored in SCRATCH zone)

EMBL: CU928166.PE214

CU928166.PE214       Location/Qualifiers
FT   CDS_pept        435558..438518
FT                   /locus_tag="KLTH0B05280g"
FT                   /old_locus_tag="KLTH-ORF15220"
FT                   /product="KLTH0B05280p"
FT                   /note="similar to uniprot|P38827 Saccharomyces cerevisiae
FT                   YHR119W SET1 Histone methyltransferase subunit of the
FT                   COMPASS complex which methylates histone H3 on lysine 4 and
FT                   is required in transcriptional silencing near telomeres
FT                   contains a SET domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05280g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21579"
FT                   /db_xref="GOA:C5DCR8"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="InterPro:IPR024636"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR8"
FT                   /protein_id="CAR21579.1"
FT                   /translation="MSDYYGRGYDSPYQRYSRGHNGRRAGRRHGGRPPKRESHQYGYSR
FT                   RDEYLHGETYFPPSSRMSKPVNAVVEPLRPKPQLRFNNDSFREKYHYFDPVSEKLLHRD
FT                   EMKSWASEKLPKTGYVIVQDQSKDKTRAVMKPRCPDQKAVDPRSQSSPSPESGVYRKRR
FT                   NQLVSLPRLVYDKHSVGPPPPNEIVVYPVFRDHSSAVQDIAIKNYFSTFGEISHFQSFN
FT                   DPISALPLYVYVVRYTGPPGNLDAPFRAAYKAAKTFENSHYFVSGFKFAVSINRANYSQ
FT                   KIVDGFIQDNIKQAAKIKKEVERQNSQKQISSGPQAKRLPRDLERVVNGRPSLLVLKRF
FT                   ISIHGLTVEDFKIKLAKYKFSRVLNHSTGIYIVFNDISDARACMFVENDVLAMPSKRRR
FT                   TPVKVRFSLIESQPSIVATVKRDGLRDQKKTYASEEQLLETAADLIIDELGRALDRDIK
FT                   RRVIGPLVFDSLNPANYPAITAKKDEEEERKSEQRRVAAEQKQDQQSKSASFDIFNLYG
FT                   ARFRKKNYIKSQIGEQSEPEYESKLKFSSSLKDSGQEKPMAHLLNESSRSNTPLAAENF
FT                   KSDDEQAQSAVEDDEDEEGFSDVSELPEKKIKTGSSEATTPETESNKYVLNSSRIQELL
FT                   RIPEKYRPDASEEPKTIYPQDDFDSYEFSSVSLGDFQRAVKDEEDFETLKNILNPPSSA
FT                   LSSNEEYILHSLVHEVSTEAEERHKVSKLQTSANEVPFDESLRSSAGSFKAGGFKKIPD
FT                   KLKNCYLPHRRKLHQPLNTVYNHQDTPEAVTDVHRNESEKLDMDAHAQEVSSSRVNRAI
FT                   NRRFQQDIEAQKAMIGSESELLTLNQLTKRKKPVTFARSAIHNWGLYALEPIAAKEMII
FT                   EYVGEILRQPVAEMRERTYLKSGIGSSYLFRVDESTVIDATKKGGIARFINHCCDPSCT
FT                   AKIIRVGGRKRIVIYALRDIAANEELTYDYKFERETDDEERLPCFCGAPTCKGFLN"
     atgtctgact actatggccg aggctacgat tcaccgtatc aacgatattc cagaggacac        60
     aacggaagaa gagccggtag gcgacacggt ggtcggcctc ctaagaggga gtcccatcaa       120
     tatggatact cgcgaaggga tgagtatctg cacggtgaaa catactttcc gccttcctct       180
     agaatgtcca aaccggtaaa cgcggttgtg gaacctttaa gaccaaagcc tcagctaagg       240
     ttcaataatg acagctttag agaaaagtat cattacttcg atcctgtatc ggaaaaacta       300
     cttcatcgag acgaaatgaa gtcatgggct tcggaaaagc ttccaaagac gggatacgtc       360
     attgtacagg atcaatcaaa agacaaaacg cgagccgtca tgaagccaag gtgccctgac       420
     cagaaggcag ttgacccgag gtcacagagc tctccaagcc cagaaagcgg cgtttataga       480
     aagcgtcgca accagttagt tagcttgccc aggctggtat atgacaagca ctccgttggc       540
     ccgccaccac caaatgaaat tgttgtgtac ccggttttcc gcgatcattc aagtgcagtg       600
     caggacattg caatcaaaaa ctattttagc acgttcggcg aaatctcaca ttttcaaagc       660
     ttcaatgatc caatcagtgc cctcccgctg tatgtatatg tcgtgagata tacggggcct       720
     ccagggaatt tggatgcacc atttagagca gcttataaag ctgcgaagac ttttgaaaat       780
     agccactact ttgtttctgg cttcaaattt gctgtctcca taaacagagc taattattca       840
     caaaagatcg ttgacggctt tatacaagat aatatcaagc aggcagcaaa gataaaaaaa       900
     gaagtggaaa ggcaaaatag ccaaaaacaa atatcatcag ggccacaagc caaacgacta       960
     cctcgggact tggaaagagt agtgaatgga cgaccttctc ttcttgttct caaaagattt      1020
     atttctatcc atggtctcac tgtggaagat ttcaaaatta agctggcaaa gtacaagttt      1080
     tcaagggtct tgaaccactc gactgggata tacattgtgt ttaatgatat ctcagacgca      1140
     agggcgtgta tgtttgtgga aaatgacgtt ttggctatgc cttctaaaag aaggcgaaca      1200
     cctgtcaaag ttagattcag tcttattgaa tctcagccct caattgtagc aactgtgaaa      1260
     cgtgatggac ttagagacca gaaaaaaacc tacgcttccg aggaacaatt gttggagacc      1320
     gctgccgact tgattattga tgagcttgga agggcgcttg acagggacat aaagaggcga      1380
     gttataggac ctttagtttt cgattcttta aatcctgcca actatccggc tattacggcg      1440
     aagaaagacg aagaagaaga gcgcaaaagt gagcaacggc gtgtcgctgc cgaacaaaag      1500
     caagatcagc agtctaagtc cgcaagcttt gacattttca acttatatgg cgcgcgcttt      1560
     agaaagaaaa actatatcaa aagccagata ggagagcaaa gcgagcctga atacgaaagc      1620
     aagctcaagt tctcttcttc acttaaagat tctgggcaag aaaagccaat ggcccatttg      1680
     ctcaatgaga gttccaggag caatacacca cttgccgccg agaacttcaa atcagatgac      1740
     gaacaagcgc aatctgcggt tgaggatgac gaagatgaag agggtttttc agatgtttct      1800
     gagctcccag aaaagaaaat aaaaactggt tcatctgaag ctacaactcc tgaaactgag      1860
     tccaacaaat atgttttgaa cagctcgaga attcaggaac ttttgagaat tcccgagaaa      1920
     taccgccccg atgcatctga agagcctaaa acgatttatc ctcaggatga cttcgattct      1980
     tacgaattct cttcagtttc actaggagat tttcaaaggg ctgtcaaaga cgaagaggat      2040
     tttgagactc taaaaaatat cctaaatccg ccatcgtcag cgctaagcag taatgaagag      2100
     tatattttgc attccttagt ccacgaagtg agtacagaag ccgaagaacg ccacaaggtt      2160
     tcgaaattgc agacttctgc caatgaggtt ccattcgatg aatccctaag aagttcagct      2220
     ggcagtttca aagcaggagg gttcaaaaag attcctgaca agctcaaaaa ttgctatttg      2280
     cctcatcgca gaaaacttca ccagcctctc aacaccgtct acaaccatca ggatacccct      2340
     gaagctgtca cggatgtcca ccggaatgaa tctgaaaaat tggatatgga cgcacatgcg      2400
     caagaggttt cttcctcacg ggttaaccgc gcaataaaca ggcgatttca acaggacatt      2460
     gaggctcaga aagcaatgat cggatctgaa tccgaacttc taaccttgaa ccaattaacg      2520
     aaacgtaaaa agcctgtgac atttgcacga tctgcaattc ataattgggg cttatacgct      2580
     cttgaaccta ttgccgctaa agaaatgatt atcgagtacg ttggagagat attgaggcag      2640
     cccgttgcag agatgaggga gcgcacatac ctcaaaagtg gaattgggtc aagttactta      2700
     ttcagggtgg acgaatcgac ggtgattgac gccacaaaga aaggcggtat tgcgagattc      2760
     atcaatcact gctgtgatcc gagctgtaca gctaaaatta tcagagtggg tggtagaaag      2820
     aggattgtga tctatgctct ccgtgatatt gcggctaatg aggagctgac ttacgactac      2880
     aagtttgaaa gagaaacaga tgatgaagaa aggctcccct gcttctgcgg tgcccccaca      2940
     tgtaaaggct tcttgaactg a                                                2961
//

If you have problems or comments...

PBIL Back to PBIL home page