(data stored in SCRATCH zone)

EMBL: CU928166.PE215

CU928166.PE215       Location/Qualifiers
FT   CDS_pept        438719..441667
FT                   /locus_tag="KLTH0B05302g"
FT                   /old_locus_tag="KLTH-ORF15217"
FT                   /product="KLTH0B05302p"
FT                   /note="similar to uniprot|P25846 Saccharomyces cerevisiae
FT                   YHR120W MSH1 DNA-binding protein of the mitochondria
FT                   involved in repair of mitochondrial DNA has ATPase activity
FT                   and binds to DNA mismatches has homology to E. coli MutS
FT                   transcription is induced during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21580"
FT                   /db_xref="GOA:C5DCR9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR9"
FT                   /protein_id="CAR21580.1"
FT                   /translation="MGRFLSYTKRLSIPNAGILGYCAARPKTGSLLSHLSGNIHQERRC
FT                   FSSVPSTEKLTVPIEHGPGTANADASRLNIELGLPLDNKSIKRSNRGNRTIKNSLPPSL
FT                   QYVRDTMDKYKDFVVLTQMGSFYELYFEHADIYAPKLNLTLTSREYAHGKVSFAGFPVQ
FT                   QVNRHLKVLVKELGYSVAIADQFKRTSAASNESNRFLRRVTRIVTPGTFLDEAFENLQE
FT                   NTYLLSIEFPESCVQKLVDINMKVGLCWCDISTGEIFVQQTLLKDTISAVARIGPREIL
FT                   LDEELFSFKLEEGEWYPEFVELKRFFIKYQKMPSNHRSMNTFRYLFNSGYLEGDFFRLE
FT                   NVLHDFSQKEVAALRNMLLYIEEHLPDTAVNLQEPQRQLTNSLMQIDSRSCSALEITST
FT                   MRANTKKGSLLSAIKRTVTPSGSRLLSQWLSAPSLDTAEIKRRQQLVTLFRNNHELTEL
FT                   LIRTLKQTYDMPRILQKFSFGKGDATELLQLSHSLQKAEFIGKSIKAKCRTKQGVLGNI
FT                   LSSVISPLEYDKQLIGRVLSSLDEDQLMKFTMLQSESESELCEKDQNLEKKDVDAFGES
FT                   SLWVIRPGAGTRISELHGKHQELLKRRRELCNRFESTISDSVQVKGVQLRLRHTGEYGL
FT                   YISATSTNIKLLCSLVKDGMLFRGSPLKILQKSSQSCWLDHRLWTELGQELEYIVMKIK
FT                   REENIVISSFKKEFIKKSFSIRRVSQVLDYLDVLTSFAKLSTEKNLSCPVVDTSSDLDI
FT                   KSGRHIVVEDGLLSKSLQKFTSNDCRLEASNLWVITGPNMGGKSTFLRQIAIIVIMAQI
FT                   GSYVPCESAKIGVVDKIFSRIGSADDLYNQMSTFMVEMTETGYILKGATKRSLAILDEI
FT                   GRGTSGKEGISLAYAALKYLVDRNQCRSLFATHFGQELKTLVDNHCDEAVRKKISYYRS
FT                   GVYDTGGDDFCYDHSLTPGICNNSDAIRVAMRAGFPKEALDNARKALKLSDT"
     atgggacgct tcctaagtta caccaaaagg ctctcgattc ctaatgctgg gatcctagga        60
     tattgcgctg ctcgccctaa gacaggaagt cttctatccc atctctcggg gaacatacat       120
     caggaacgcc ggtgcttttc ttctgttccc agcacggaga agctgactgt accgatagag       180
     catggaccgg gtaccgctaa tgcggatgcg agcagactta atatagaatt gggtcttcca       240
     ttggataata agagcattaa gaggagcaac cgaggcaata ggactataaa aaattctcta       300
     ccgccctcgc tacagtacgt tcgtgatacc atggacaaat ataaagactt tgtggttttg       360
     acgcaaatgg ggtcatttta tgaattatac tttgagcatg cagacatcta cgctcccaaa       420
     ctgaacttga ctcttactag tcgcgaatat gctcatggta aagtttcatt cgcaggattt       480
     cctgtacaac aagtcaatag acacctgaaa gtattggtca aagaactggg ttatagcgta       540
     gctatagctg atcaattcaa gagaacttca gccgccagta atgaaagcaa tagatttttg       600
     agacgagtaa ctcggattgt cacacctgga actttcctgg acgaagcatt cgaaaactta       660
     caggaaaata cttaccttct tagtattgaa ttcccggaaa gctgtgtgca aaaacttgtt       720
     gacattaaca tgaaggttgg gctctgctgg tgcgatattt caacaggtga gatttttgtt       780
     cagcaaacac tcttaaaaga tacaatatcg gctgtcgcta gaattggacc tcgggagatc       840
     ctcttggatg aagagctgtt ctctttcaag ctggaagagg gagagtggta ccctgaattt       900
     gtggaattga agagattctt catcaaatat caaaaaatgc cctcgaatca cagaagcatg       960
     aacaccttca ggtacctttt caatagtgga tatttggagg gagatttttt tcggctagaa      1020
     aatgtcttac atgacttttc tcaaaaagag gttgcagcct tgagaaatat gttactatac      1080
     attgaagaac acttacctga tactgcagtt aacttacaag agccccagag gcagctcaca      1140
     aattcgctaa tgcaaattga ctcacggtcg tgctctgccc tggaaatcac ctcaacaatg      1200
     cgagctaaca cgaaaaaagg atcacttctt tcggcaataa agcgcacggt aacgccttca      1260
     ggaagcagac tcttatcaca gtggctttct gctccttctt tagatacggc ggaaatcaag      1320
     cgcaggcagc agcttgtgac tttatttcga aataatcatg agttgacgga acttcttatc      1380
     aggacactca agcaaactta cgatatgccg cgcattcttc aaaagttttc tttcggtaaa      1440
     ggagacgcca ctgaattatt gcagctatca cattctttgc aaaaggctga atttattggg      1500
     aagtccataa aagctaaatg tcgcaccaaa cagggcgttc ttggaaacat tttgagttcc      1560
     gtcataagtc ctttagaata tgacaaacag ctgataggaa gagtgctttc ttctctggat      1620
     gaagaccagt taatgaaatt cacgatgctt caatctgagt ctgaatctga actttgtgaa      1680
     aaagaccaaa atcttgaaaa gaaagatgtt gacgcctttg gtgaatcaag cctttgggtt      1740
     attcggcctg gcgcgggcac cagaatttca gaattgcatg gcaaacatca ggagctgcta      1800
     aagaggcggc gagagctgtg caatcggttc gagtcaacta tatcagatag cgttcaagtt      1860
     aaaggtgttc agttgaggct aaggcatact ggcgaatacg gactgtacat ttcagcgact      1920
     tctaccaata ttaaattgct ttgcagttta gtgaaggacg gaatgctctt tcgaggcagc      1980
     cctctcaaga ttttgcagaa gtcctctcaa agctgctggt tggaccacag attatggact      2040
     gagctgggcc aggagctgga gtatattgtt atgaagatca agagagaaga aaacatagtg      2100
     ataagctcgt tcaaaaagga atttataaaa aagagcttct ctatacgacg cgtttctcaa      2160
     gttttagact atctcgatgt tctcacttcc tttgccaaac tctcgactga gaaaaatctt      2220
     tcctgccctg ttgttgatac tagttctgac ttggacatca aaagtggtcg tcatatagtg      2280
     gtggaagacg gattgctctc taaatctttg caaaaattta cctcaaatga ttgtcgacta      2340
     gaagctagca atctttgggt tataacagga ccaaatatgg ggggcaaatc gacgtttctc      2400
     aggcaaattg caataattgt tattatggcc caaattggtt cttatgtccc ttgtgagtca      2460
     gctaaaattg gtgtagtaga taaaatcttc agccggatag gttcagcaga tgacttgtac      2520
     aatcaaatga gtacttttat ggttgaaatg actgagacgg gctacattct taaaggcgct      2580
     accaaaagat cactagctat cttggatgaa atagggcgag gcacgagtgg caaggaaggg      2640
     attagtcttg cgtatgcggc tttgaaatat cttgtcgata gaaatcaatg cagatcgcta      2700
     tttgccactc atttcggtca agagctgaaa acgcttgttg ataatcattg tgatgaggca      2760
     gttcgaaaaa aaatatcgta ctatagatct ggagtttatg acacaggcgg agatgatttc      2820
     tgttacgatc atagtctcac ccctggaata tgtaacaact ctgatgcaat aagagttgca      2880
     atgagagcag gatttcctaa ggaggcacta gataacgccc gaaaagcttt gaaactctct      2940
     gatacttaa                                                              2949
//

If you have problems or comments...

PBIL Back to PBIL home page