(data stored in ACNUC8465 zone)

EMBL: CU928166.PE218

CU928166.PE218       Location/Qualifiers
FT   CDS_pept        complement(446569..449364)
FT                   /locus_tag="KLTH0B05368g"
FT                   /old_locus_tag="KLTH-ORF15210"
FT                   /product="KLTH0B05368p"
FT                   /note="similar to uniprot|P53917 Saccharomyces cerevisiae
FT                   YNL127W FAR11 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far3p Far7p Far8p
FT                   Far9p and Far10p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05368g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21583"
FT                   /db_xref="InterPro:IPR012486"
FT                   /db_xref="InterPro:IPR021819"
FT                   /db_xref="InterPro:IPR040185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS2"
FT                   /protein_id="CAR21583.1"
FT                   /translation="MLRPAGCEVTKIRPAMPEGVKTRSPLIRSISSKDLRRKGGRRNGY
FT                   LSPENSSNKDANDSSSEAEEHLLQDLDNILYKKLHLGETSPNGGSVRGSPISSSPPNTH
FT                   DHSDDDQENNALDQDAEEEAENEDFANVDEIDGPISPSSSSGSLKDLAKANVNKGTDQT
FT                   LNNDIDYNLPVDKEFQNQLNKRAEEIEKDGSIFQSSRTTLEWSIQDFYSLYDELPDWFC
FT                   SVDYNMLGDAKRCFEKSFSPTRFTVEHSYAASVLEQLTSDLQNCNNEASCTLSLAYICM
FT                   GTFGNKKSLIEHIKAIKNNNFLLVPHLSVLLKSFKKFASHCREGKSHLKHYTNLFFNCS
FT                   TILFFLVNVLVESKAKGQCVTETEAAIEEIYREEILEFVVKYIEYWRWNSRLSMRIRIV
FT                   IILFHRLLLLQFGDMQYFEEVKEYVHKKHNIKKRENGPGALAISPLDYQAFREDVTSRF
FT                   PTFVPPESDIPASFDNSNSLSQFLEIPRPKSKSTLNSNLSAPECHIATPVPSPCSSPTS
FT                   QMRGSKSRKSFQTNLAYPSLYPCDDTDGSDPLSSRIRAPGCGEGETQIPFSVLEATDIL
FT                   HKNVEIKLSTRQLWHERELFMKQERGWGSTHESPSEFLYHYNNENNGEARTMVRIEEFY
FT                   KKCLPSLSSIAYVLLQTMESNLNNRTYVRDDTKDESSGLQTAPQLEIIRSKEIVLKSSC
FT                   SSLYLLMKWLKLSHILKFEQFCVILHDYKLIGIVTSLLNTYTDKYQERVFGNVLQPTHS
FT                   FWKACSSYNADSYDISTNKTVLSHENLDLRFLNTVVYLLRLLSKVTGCKTQRLKELPLA
FT                   IGTLLKTFYQIFNLDIYQPILKITQELTPFKNKKWKSEHMDLISGVYLYRRLKLSDNWV
FT                   TGKDITGELNDACGQEIALRALLQFYNFLHYKPSIEHLGYHDKSDFSFFSKEAEILTSV
FT                   H"
     atgttgaggc ctgctggttg cgaagtaaca aaaattaggc ctgctatgcc agaaggggtg        60
     aagacaagat ctccgttaat aagatctata tcttcaaaag accttagaag gaaaggaggc       120
     cgccgaaatg gctatttaag tccagagaat tcttcaaata aagatgccaa cgattcgtcc       180
     tcagaagccg aagaacactt gctacaagat cttgataata ttctttacaa aaagttgcat       240
     ttgggtgaaa caagtcccaa cggagggagt gtgcgtgggt ctccaatatc aagttcgcca       300
     ccgaacacgc atgatcactc agacgatgac caagagaata atgctttaga tcaagacgcc       360
     gaggaagaag cagagaatga ggacttcgct aatgtggatg agatagatgg ccctatttcc       420
     ccttcatcga gtagcggaag cttgaaagac cttgcaaaag ctaatgttaa taaaggcaca       480
     gaccaaactt tgaacaatga catcgattat aacttacccg tggataaaga gtttcaaaat       540
     caacttaaca aacgagcgga agaaatcgag aaagacggtt ctatatttca atcttcgaga       600
     acaacgttgg aatggtcaat ccaggatttt tattccctgt atgatgagct ccccgactgg       660
     ttttgctctg tcgactacaa catgctgggc gacgcaaagc gctgctttga aaagagcttc       720
     agtcctaccc gcttcacagt ggaacattcg tatgctgctt ctgtattaga gcagctgaca       780
     tcagatctcc aaaattgcaa taacgaagct tcttgtaccc tttcgcttgc ttacatttgc       840
     atggggacat tcggaaacaa gaagagttta attgagcata ttaaggcgat taagaacaat       900
     aactttctgc ttgtgccgca tttaagcgtt ctgttaaagt cattcaaaaa gtttgcctct       960
     cattgtagag agggaaagtc tcacttaaag cattacacta acctgttctt caactgcagc      1020
     accatactgt ttttccttgt taatgttcta gtggaatcaa aagccaaagg gcagtgtgta      1080
     acagaaacag aagccgcaat tgaagaaatc tacagagaag aaatcctcga atttgtcgta      1140
     aaatacatcg agtactggag gtggaatagc cgcttgagta tgagaatcag aattgtaata      1200
     atactctttc atcggcttct tttgcttcaa ttcggtgata tgcagtactt cgaagaagtt      1260
     aaggaatacg ttcacaaaaa gcacaacatt aagaaaagag agaatggccc cggcgcctta      1320
     gcaatcagtc cattggacta ccaagcgttc agggaagatg taacatcgag gtttcctact      1380
     tttgttccac ctgaatctga tattcccgct agctttgata actcaaactc cctatcacag      1440
     tttttggaaa tccctcgacc aaaatcaaaa agcacgctta actctaacct tagcgctcca      1500
     gaatgccata ttgctactcc agtgccttcc ccgtgctcct cgcccacttc ccaaatgcga      1560
     ggctcaaagt cacgaaaatc atttcaaaca aatttggcat acccttccct gtacccttgt      1620
     gatgatacag atgggtctga cccgctttcg tcgcggatcc gtgctccagg atgtggggaa      1680
     ggtgaaacgc aaataccatt tagcgttttg gaagccactg acatccttca taaaaatgtg      1740
     gagataaagc tttccacgcg acaactttgg catgagcgcg agcttttcat gaaacaagaa      1800
     agagggtggg gctccacaca cgaatcgcca tctgaatttt tgtatcacta caataatgag      1860
     aacaatgggg aagctagaac aatggttagg atagaagaat tctacaaaaa atgccttccc      1920
     agcttaagtt caatcgcata tgttcttctg caaactatgg aatccaattt gaataaccgc      1980
     acatatgtcc gcgacgacac gaaggatgaa agctcagggc tgcaaactgc accgcagctt      2040
     gaaattatcc gatctaaaga aatagtgctc aaatcttcat gctcaagtct atacctcttg      2100
     atgaaatggc taaagcttag ccacatttta aaatttgaac aattttgtgt gatccttcat      2160
     gattataagc ttatcggcat cgttaccagc cttctcaaca catacacgga caagtaccag      2220
     gagcgagtgt ttggtaatgt tttgcaaccc acacactcat tttggaaagc atgctcctca      2280
     tacaatgctg attcttacga tatctcaacg aataagaccg tgttgagcca tgaaaatctt      2340
     gaccttcgat ttttgaatac agtggtatat ctattgaggc ttctaagcaa agttaccggc      2400
     tgcaaaaccc aacgacttaa ggaattacct ctcgcgatcg ggacgcttct caagacattt      2460
     tatcagattt tcaatctaga catctatcag cccatcctta agataaccca ggagctcaca      2520
     ccttttaaaa acaaaaaatg gaaatcagaa catatggatc ttatttctgg tgtctacttg      2580
     tacaggagac taaaactcag cgataattgg gttacgggga aagatataac cggagaactg      2640
     aatgacgctt gcgggcaaga gattgcactg cgagctttac ttcagtttta caactttttg      2700
     cattacaaac cttcaatcga gcacctgggc tatcacgata aaagcgattt ctcgttcttc      2760
     agcaaagaag ctgagatctt gaccagtgta cactaa                                2796
//

If you have problems or comments...

PBIL Back to PBIL home page