(data stored in ACNUC8465 zone)

EMBL: CU928166.PE222

CU928166.PE222       Location/Qualifiers
FT   CDS_pept        454571..455239
FT                   /locus_tag="KLTH0B05456g"
FT                   /old_locus_tag="KLTH-ORF15200"
FT                   /product="KLTH0B05456p"
FT                   /note="similar to uniprot|P38829 Saccharomyces cerevisiae
FT                   YHR122W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21587"
FT                   /db_xref="GOA:C5DCS6"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS6"
FT                   /protein_id="CAR21587.1"
FT                   /translation="MSEFINENPDILDENLLPSRKEEEGDAFQDEALNTVNLLRRKRLL
FT                   KIHQTTACKVYRNVELIDRLKAQEMALDQVPDLTASETEESDEGEPEDPIDAQEIYDMI
FT                   AHISDPEHPLTLGQLAVVNLPDIEVSESNDKSKISEVLVKITPTITHCSLATLIGLGIR
FT                   VRLERSLPSRYRITILLKEGSHQSENQVNKQLNDKERVAAACENDQLLGVVSKMLSTCK
FT                   "
     atgtcagagt tcatcaatga aaatcctgat attctagacg aaaatctcct tccttcaagg        60
     aaagaagagg agggagacgc atttcaagat gaagctctta acacagtcaa cttgctacga       120
     aggaagcgcc ttttgaaaat acatcaaacc acagcttgca aggtgtatcg aaacgtcgag       180
     ctaatagaca ggctgaaagc acaagagatg gctcttgacc aggttccaga cctgactgca       240
     tctgagaccg aagagtctga cgaaggcgag cctgaagatc ctatcgacgc gcaagaaatc       300
     tacgacatga tcgcgcacat ctcagatccc gagcatcctc tgacccttgg ccagcttgcg       360
     gtcgtgaacc tccccgacat tgaagttagc gaaagtaatg acaaatcgaa aatttctgaa       420
     gttttagtca agattacgcc aactattaca cactgttctc tagctacgct gataggactc       480
     ggaatacgcg tgagacttga gaggtcgtta ccctcccgct acagaataac catcttactg       540
     aaagagggct ctcatcaaag cgaaaatcaa gttaacaagc agctcaatga taaggaaaga       600
     gttgctgctg cttgtgagaa cgatcagctt ctgggggttg tctctaagat gttaagtact       660
     tgcaaatag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page