(data stored in ACNUC8465 zone)

EMBL: CU928166.PE225

CU928166.PE225       Location/Qualifiers
FT   CDS_pept        complement(457520..460687)
FT                   /locus_tag="KLTH0B05522g"
FT                   /old_locus_tag="KLTH-ORF15196"
FT                   /product="KLTH0B05522p"
FT                   /note="highly similar to uniprot|P53914 Saccharomyces
FT                   cerevisiae YNL132W KRE33 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21590"
FT                   /db_xref="GOA:C5DCS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033688"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS9"
FT                   /protein_id="CAR21590.1"
FT                   /translation="MAKKAIDSRIPSLIRNGAQTKQRSFFVIVGDKARNQLPNLHYLMM
FT                   SADLKMNKSVLWAYKKKLLGFTSHRKKREAKIKKEIKRGTREVNEQDPFETFISNQNIR
FT                   YVYYKETEKILGNTYGMCILQDFEALTPNLLARTVETVEGGGIVVILLKSMTSLKQLYT
FT                   MTMDIHSRYRTEAHSDVVARFNERFILSLGSNENCLVVDDELNVLPISGGKNVQPLPPK
FT                   DEDEIPPRQQELIELKESLEDVQPAGSLVALSKTVNQAQAILNFIDAISEKNLNSTVAL
FT                   TAGRGRGKSAALGIAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHMDY
FT                   DIIQSTNPSFNKAIVRVDIKKSHRQTIQYIVPNDSHVLGQAELVVIDEAAAIPLPVVKN
FT                   LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRDQANSSGRETSETMVVSRDNKKQDFHA
FT                   SGRSLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHPSECNLFVVN
FT                   RDTLFSYHPVSETFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLLPPINPKDGGR
FT                   IPDPLVVIQVALEGEISRDSVKSSLSRGQRAGGDLIPWLISQQFQDEEFPSLSGARVVR
FT                   VATNPEYSSMGYGSRAIELLRDYYEGKFADLNENSKPASHELKRVNDQELSKTNLLKDE
FT                   VKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTSSLHKFWKKNKFVPVYLRQTANDLT
FT                   GEHTCVMLNVLEGRESHWLSEYANDFHKRFLSLLSYEFRKFSAVQALNVIESVKKANGL
FT                   SGNAENKHAARPLTKEDIDQVLSPFDLKRLDSYANNLLDYHVIVDLLPLLSSLYFSGRM
FT                   GSSVNLSSVQSAILLAVGLQRKSVDDVSKELNLPFNQAIAMFAKIIRKFSIYFREVVSQ
FT                   SIERSMPEAKDDNIAEMNGEEVTALDASSVMEKMDDDLEKAGTRALTAMQEKQKELINS
FT                   LNLDKYAIDDNAEEWAQSKKDLDKAAKKNGTVAVKSNKKRKTENAEDIFNAEMSAVKKS
FT                   SKKKPKK"
     atggcgaaaa aggcgatcga ctcccgtatc ccatcgctta taagaaatgg tgctcaaacc        60
     aagcagcgga gctttttcgt cattgtgggc gataaagcgc gtaaccagtt gccaaatctg       120
     cactacttga tgatgagtgc ggacttgaag atgaacaagt cagtcttgtg ggcgtacaaa       180
     aagaagcttt tgggcttcac ctcgcaccgc aaaaagagag aagcgaagat caagaaagag       240
     atcaagcgcg gtacgcgtga ggtcaatgag caggatccat tcgaaacctt catctcgaac       300
     caaaacatta gatacgttta ctacaaggaa accgagaaga ttctgggtaa cacatatggt       360
     atgtgtattc tgcaagattt cgaggctcta acccctaacc tccttgcacg taccgtggaa       420
     actgtcgaag gtgggggcat cgtcgtcatt ttactgaaat cgatgacttc gctgaagcag       480
     ctgtatacca tgaccatgga tatacattcc cgctacagaa cagaggccca cagcgacgtg       540
     gttgctaggt tcaacgagcg gtttatttta tccctgggct ccaacgaaaa ctgcctcgtg       600
     gtcgacgacg aactcaacgt gcttccaatc tctgggggca agaacgtcca gccccttcct       660
     cccaaggacg aggacgagat cccaccgaga caacaggagc ttattgagct aaaggagtct       720
     ttggaggatg tacaacccgc tggttccctc gtagcactgt cgaagaccgt caatcaagct       780
     caggctattc tgaactttat cgatgctatt tccgagaaaa acttgaattc gacagttgcg       840
     cttacggccg gaagaggtag aggtaaatct gcagcgttgg gtattgcgat tgcagccgca       900
     gtctctcatg ggtactccaa catttttgtc acctctccat ctccagaaaa cttgaagact       960
     ctattcgagt tcatattcaa aggtttcgat gctcttggat accaggagca tatggactat      1020
     gacatcattc agtccactaa cccaagcttt aacaaggcaa ttgtgagagt tgatataaag      1080
     aagagccaca gacagaccat tcagtacatt gtgcccaatg actcccacgt gttaggacaa      1140
     gcagagcttg ttgtcataga tgaggcagcg gctattccgc ttcctgtggt taagaacctt      1200
     ttgggtccat atttggtgtt tatggcatcg acaattaacg gttacgaggg taccggtcgg      1260
     tccctatctc taaaattgat ccagcagctt agagaccagg ccaactcctc cggcagagag      1320
     acttcagaga cgatggttgt gtcaagagac aacaaaaaac aggatttcca cgcatccggg      1380
     aggtcattga aggaggttgt tcttgatgag cctatcagat acgcgcctgg tgatcccgtt      1440
     gagaaatggc tgaacaaact tctttgtcta gacgtcacct taattaaaaa tccaaggttt      1500
     gccgctagag gaactcctca tccatcggaa tgtaacctgt ttgttgtgaa cagggatacg      1560
     ttgttctctt atcacccagt atcagagacc ttcctggaga aaatgatggc actatatgtg      1620
     gcgtcacact acaagaattc accgaatgat ctgcaactca tgagcgatgc cccagcacac      1680
     cagctctttg ttcttctacc accaatcaat ccaaaggatg gcggaagaat cccggatcct      1740
     cttgttgtta ttcaggtcgc tttggaaggt gaaatctcta gagatagcgt aaagtcttcg      1800
     ctttcgcgtg gccagagagc aggtggcgac cttatcccat ggctgatttc tcaacagttt      1860
     caagatgaag agttcccaag cttgagtggt gctcgcgttg ttcgcgtggc cactaaccca      1920
     gagtactctt cgatgggcta cgggtctaga gctattgagc ttttgagaga ctactacgaa      1980
     ggcaaatttg ccgatcttaa cgaaaattcg aagcctgcat cgcatgaact aaaaagagtc      2040
     aacgatcagg agctttcaaa gaccaatctc ttaaaggacg aagtcaaact gagagatgcc      2100
     aaaacacttc cgcctttatt gttgaagctt tctgagcagc ctcctcactt cttgcattac      2160
     ctgggcgttt cctatggact gacaagcagc cttcacaagt tttggaaaaa gaataagttt      2220
     gtgccagtat acttacgcca aactgctaac gatttgaccg gggagcacac ttgcgtaatg      2280
     ctcaacgtcc ttgaagggag agagtctcac tggttgtcag agtatgccaa tgactttcac      2340
     aaacgtttcc tctctctgct ttcctatgaa tttaggaagt ttagcgcggt tcaagcgctc      2400
     aatgtgattg aaagcgttaa aaaggcaaac ggcttgtctg gtaacgcaga gaacaagcac      2460
     gcagctcgtc ctctaacgaa agaggacatt gatcaagttc tttctccctt cgatctcaag      2520
     agactcgaca gctacgctaa caacttacta gattatcatg tcattgttga cctcttgcca      2580
     ctgctgtcat cactttactt ctcaggccgc atgggcagca gtgttaatct ctccagcgtc      2640
     caaagtgcga ttttgctagc tgttggcctt caacggaaaa gcgtcgatga tgtctctaag      2700
     gaactgaacc tcccattcaa tcaagctatt gcaatgttcg caaagatcat aaggaaattt      2760
     tcaatatatt tccgcgaggt tgtgagtcag tccatcgaac gttctatgcc agaagccaaa      2820
     gatgacaaca ttgcagaaat gaatggcgaa gaagttactg ctttggatgc ttccagtgtt      2880
     atggaaaaaa tggacgatga cctcgaaaaa gccggtacac gcgctctcac tgccatgcag      2940
     gagaaacaga aagaactcat caattcactc aacctagaca agtacgccat tgatgacaat      3000
     gctgaagaat gggctcagtc caaaaaggat ctcgacaagg ctgccaagaa gaacgggaca      3060
     gttgctgtaa agtcgaataa gaagagaaaa acggaaaacg ctgaagatat cttcaacgct      3120
     gaaatgagcg ccgtcaaaaa gtcatcaaag aaaaaaccca agaaatga                   3168
//

If you have problems or comments...

PBIL Back to PBIL home page