(data stored in ACNUC8465 zone)

EMBL: CU928166.PE227

CU928166.PE227       Location/Qualifiers
FT   CDS_pept        463936..464478
FT                   /locus_tag="KLTH0B05588g"
FT                   /old_locus_tag="KLTH-ORF15189"
FT                   /product="KLTH0B05588p"
FT                   /note="weakly similar to uniprot|P53913 Saccharomyces
FT                   cerevisiae YNL133C FYV6 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin
FT                   proposed to regulate double-strand break repair via non-
FT                   homologous end-joining"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05588g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21592"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT1"
FT                   /protein_id="CAR21592.1"
FT                   /translation="MSTRQENDLQSSRFVKEGNADIELQRQRERQESAKLDTDFRTKER
FT                   LTLQDQLRLNAITKQEEFSSLVKDRNSFNRLSKQDVEFYESLQRRAQLENQSLEEFLEK
FT                   NTREYDKKKAQVLAHESGRPESVPTRVQVPAKITKKRSMPSKNGIKGVIKKKKSKSNHE
FT                   VPENRDHSKVETSKGSN"
     atgtccacaa ggcaggagaa tgacttgcag agttcaaggt tcgtcaaaga gggcaacgca        60
     gatattgagc tgcagaggca gcgtgagcgt caagagagcg ctaaattgga cactgatttt       120
     aggaccaaag agcgcttaac tctacaggac cagctgaggc tcaacgctat tacaaagcaa       180
     gaagagttca gctcgctagt gaaagaccgc aatagcttta atcgacttag caaacaggac       240
     gtagagtttt acgagagtct gcagaggagg gcgcaacttg aaaatcagag ccttgaagaa       300
     tttctggaga agaacacccg agaatatgac aagaaaaagg cgcaagtgct tgctcacgag       360
     agcggacgcc cagaaagcgt accgaccaga gtgcaagttc ctgcgaagat taccaaaaag       420
     cgcagcatgc cgtccaaaaa cggcatcaag ggcgtgataa agaaaaaaaa atccaagagc       480
     aaccatgaag tacccgagaa ccgcgaccat tccaaggtag aaacctcgaa gggctccaat       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page