(data stored in SCRATCH zone)

EMBL: CU928166.PE229

CU928166.PE229       Location/Qualifiers
FT   CDS_pept        complement(466200..466475)
FT                   /locus_tag="KLTH0B05632g"
FT                   /old_locus_tag="KLTH-ORF15181"
FT                   /product="KLTH0B05632p"
FT                   /note="similar to uniprot|P43497 Saccharomyces cerevisiae
FT                   YKL096W-A CWP2 major constituent of the cell wall
FT                   containing GPI-anchor, plays a role in stabilizing the cell
FT                   wall, low pH resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21594"
FT                   /db_xref="GOA:C5DCT3"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT3"
FT                   /protein_id="CAR21594.1"
FT                   /translation="MQFSTVAFAAASVAVVSAASTVQAISQIGDGQIQATTSAPATEPT
FT                   TAPTTTASWTSSGNATIPTQTENGAAAMGSGFVAMAGLAAAGALLI"
     atgcaattct ccactgtcgc tttcgctgcc gcctccgtcg ccgtcgtttc cgccgcctcc        60
     accgtccagg ccatctccca gatcggtgac ggtcagatcc aggctaccac ctccgctcca       120
     gccactgagc caaccaccgc tccaaccacc accgcttcct ggaccagctc cggcaacgcc       180
     accatcccaa ctcagaccga gaacggtgct gctgccatgg gctctggctt cgtcgccatg       240
     gccggtttgg ccgccgccgg tgctttgctg atctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page