(data stored in SCRATCH zone)

EMBL: CU928166.PE230

CU928166.PE230       Location/Qualifiers
FT   CDS_pept        467957..468301
FT                   /locus_tag="KLTH0B05654g"
FT                   /old_locus_tag="KLTH-ORF15174"
FT                   /product="KLTH0B05654p"
FT                   /note="highly similar to uniprot|P20081 Saccharomyces
FT                   cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans isomerase
FT                   (PPIase) binds to the drugs FK506 and rapamycin also binds
FT                   to the nonhistone chromatin binding protein Hmo1p and may
FT                   regulate its assembly or function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05654g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21595"
FT                   /db_xref="GOA:C5DCT4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT4"
FT                   /protein_id="CAR21595.1"
FT                   /translation="MSETIEGNVKIDRLSPGDGKTFPKTGDLVTIHYTGTLENGQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATL
FT                   VFDVELLKVN"
     atgtccgaga ctatcgaagg taacgtcaag atcgacagac tgtccccagg cgacggcaag        60
     actttcccaa agaccggtga cctcgtcact atccactaca ccggcaccct ggaaaacggc       120
     caaaagttcg actcttctgt cgacagaggc tcccccttcc aatgcaacat cggcgtcggc       180
     caggtcatca agggctggga cgcgggtatt ccaaagctct ccgttggcga gaaggcgaga       240
     ctgaccatcc ctggtcctta cgcctacggt cctagaggct tcccaggtct gatccctcca       300
     aacgccaccc tggttttcga cgtcgagctg ttgaaagtca actaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page