(data stored in ACNUC8465 zone)

EMBL: CU928166.PE231

CU928166.PE231       Location/Qualifiers
FT   CDS_pept        complement(468367..469491)
FT                   /locus_tag="KLTH0B05676g"
FT                   /old_locus_tag="KLTH-ORF15171"
FT                   /product="KLTH0B05676p"
FT                   /note="some similarities with uniprot|P53911 Saccharomyces
FT                   cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
FT                   acetyltransferase complex which acetylates the N-terminal
FT                   tails of histones H4 and H2A"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05676g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21596"
FT                   /db_xref="GOA:C5DCT5"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT5"
FT                   /protein_id="CAR21596.1"
FT                   /translation="MSEPWSIEDDIRLFRWITEFKPAGMHKHFHMINILERMNKPELFP
FT                   VVLLFDKQKSESKGLFTREELWAKLSKHYDLDMLDKVEDDHTGKEAGEAASVLPLSLRR
FT                   VTKQQREFHLPWDEYGELILENAQGAMEEEQEEFENPEQSEISKERGETAESEELQGDT
FT                   ARKEEEAAEENMVADEKEHDEEPEPKPQDEELSERVPRRVTRSAAVAKPAGRITRSHGP
FT                   ADQASGVDGHESAPSEEPTNGETPVTGEEKEEDSAMGDLDGEKDKDKDESAQGAETPAE
FT                   GEPAEAEEPEQPPSKRTRTTRSQPREAPAPAPASTAPAAGSASESRSARLGGAKESVSP
FT                   PSETEPAEDAEQAAKAPPAKRSSSRVANRRRARR"
     atgagtgaac cttggagtat cgaagatgat atacggcttt ttcggtggat cacggagttc        60
     aagcctgcgg gaatgcacaa gcacttccac atgatcaaca ttctggagcg gatgaacaaa       120
     ccagagctgt tccccgttgt gcttctgttt gacaagcaaa aaagcgagag taagggttta       180
     ttcacccggg aggaactctg ggcgaagctg agcaagcact acgacctaga catgctggac       240
     aaagttgaag atgaccacac tgggaaagaa gcaggcgagg cggcatcagt actaccgctg       300
     tcgctgcgac gtgttacaaa gcagcagcgg gagttccatc tgccgtggga tgagtacggg       360
     gagcttattt tggagaatgc gcaaggcgcc atggaggaag aacaagaaga gttcgaaaac       420
     ccagaacaat cagagataag caaggaacgt ggggagaccg cggaaagcga agagctgcaa       480
     ggggacactg cacgaaagga agaagaggca gcagaggaaa acatggttgc cgacgaaaag       540
     gagcacgacg aggaaccgga accaaagccg caggatgaag agctttcgga gcgcgttccg       600
     cgccgcgtca caaggtctgc ggctgtcgct aagccagcag gccgtatcac acggtcgcat       660
     ggccctgcgg atcaggcttc tggtgtcgat ggccacgaga gtgcacctag cgaagagccc       720
     accaacggcg aaaccccagt aacgggagaa gaaaaagaag aggatagcgc aatgggcgac       780
     ctcgatggag agaaagacaa agacaaagac gaaagcgccc aaggcgcaga gacgccggca       840
     gagggcgagc ccgcggaggc cgaagaaccc gaacaacctc cttcgaagag aacacgaact       900
     acgagaagtc agccgcgcga agcgcccgcg cccgcgccag cgtccacggc ccctgctgct       960
     ggatcagcca gtgagtcgcg gtcggcgcgc ttgggcggcg ccaaggagtc ggtctcgccg      1020
     ccctcggaga cagagccggc cgaggacgcg gagcaagccg cgaaggcgcc tcccgcaaag      1080
     cggtcgagct cgcgcgtggc caaccggcgc agggcccgcc gctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page