(data stored in ACNUC8465 zone)

EMBL: CU928166.PE233

CU928166.PE233       Location/Qualifiers
FT   CDS_pept        complement(471311..472903)
FT                   /locus_tag="KLTH0B05720g"
FT                   /old_locus_tag="KLTH-ORF15164"
FT                   /product="KLTH0B05720p"
FT                   /note="similar to uniprot|P17555 Saccharomyces cerevisiae
FT                   YNL138W SRV2 Adenylyl cyclase-associated protein N-
FT                   terminal domain appears to be involved in cellular
FT                   responsiveness to RAS"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21598"
FT                   /db_xref="GOA:C5DCT7"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR028417"
FT                   /db_xref="InterPro:IPR028419"
FT                   /db_xref="InterPro:IPR036222"
FT                   /db_xref="InterPro:IPR036223"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT7"
FT                   /protein_id="CAR21598.1"
FT                   /translation="MSDPSNFAIQGFNLSKLLKRLEDATARLEDVTLYQEGYIQTKLED
FT                   LSVRGSSNEVEQKKTDHVTVEIPKSLPEKAEEQTEEESASVKGFRSIIDSRIEPLYQLS
FT                   EKIDPVVAKSIKHLQGAFEAQLSFLRVVSLSKKPDFGSESFIKALQPLNEQIMAIGELK
FT                   DENRQSKYFAYLNSVAEGAPLLSWIGVETPMSLIGDFKDAAQFWTNRILKDFKELDPSS
FT                   VEWVKGFLAIFDDLKSYVKEYHTTGPSWNNASGIEFAEAVAKIEGQSSKAVPSSTAPNA
FT                   SQGSGAPPPPPPPPAPPASVFEAQADKSENAGISAVFDELNQGENITKSLKKVDKSQQT
FT                   HKNPALRASSATPSARTPPPKPKKPTTLKTKKPARKELVGNKWFIEGYENVETPITIEV
FT                   NKDESVYIGNCSNVFVKIEGKVNAVSVSETERCNVVLESSVSGMDIIKSVKFAVQVEQS
FT                   LPQISIDKSDDGTIYLSKESLNAEIFTSCTTSVNVNLPIGEEGDFVEFPVPEQLKHSFA
FT                   DGKLKTTVYEHAG"
     atgtcggatc ccagtaactt tgctatccag ggcttcaacc tctccaaact tttgaagagg        60
     ttggaagatg ctactgcgag gctagaagat gtcaccttat atcaggaagg atatattcag       120
     acaaagctgg aagacttgag tgtgagagga agctccaacg aggttgaaca gaaaaagact       180
     gaccatgtta ctgttgagat accaaaatct ctccctgaga aagcggaaga gcagacagag       240
     gaagaatcag caagcgtaaa aggttttaga tccatcattg actctagaat cgaacctctt       300
     tatcagcttt cagagaaaat tgatccagtc gttgcgaagt ctatcaaaca tcttcagggt       360
     gctttcgagg cccaattgtc tttcctgcgg gttgtttcgt tgtcaaagaa gcccgatttt       420
     ggttctgaaa gcttcattaa agctttacag cctctaaacg aacagataat ggcaattggc       480
     gagctgaaag acgaaaatcg ccaaagcaag tactttgcgt acctaaactc agttgcagaa       540
     ggagccccac ttttgagctg gatcggtgta gagacgccaa tgtctttgat tggagacttc       600
     aaggacgccg cacaattttg gaccaataga atcctcaagg atttcaaaga gttggaccct       660
     agcagtgttg aatgggtgaa gggttttcta gcgatatttg atgatctcaa aagttatgtg       720
     aaggagtacc acactactgg accttcatgg aataatgcca gtggtatcga attcgcagaa       780
     gctgtggcca aaattgaagg gcagagctct aaggcggtcc caagttcgac tgcgccaaac       840
     gcctctcagg gctctggagc tccaccacca ccacctccgc caccagctcc cccagcttct       900
     gttttcgaag cacaagcaga caagtctgag aatgcaggta taagtgctgt atttgacgag       960
     ctgaaccagg gagagaatat tacgaaatcc ctaaagaaag ttgacaagtc tcagcagacc      1020
     cacaaaaatc ctgcgcttcg tgcctccagt gcaacacctt ctgccagaac cccaccacca      1080
     aagcccaaaa aaccaacgac cttgaagact aaaaaacctg caagaaagga acttgtgggc      1140
     aacaagtggt ttatcgaggg ctatgaaaac gtagaaactc caatcactat cgaagtcaac      1200
     aaggacgagt ctgtgtacat cgggaattgc agcaatgttt ttgtaaagat tgaaggtaag      1260
     gttaatgcag tctcggtgag cgagactgag cgttgtaatg ttgttctgga gagcagcgtg      1320
     tctggaatgg acattatcaa gtccgtgaaa tttgctgttc aagttgaaca gtcactccct      1380
     caaataagta tcgataaaag cgatgacggt accatctact tgagcaagga gtcattaaat      1440
     gcagagatct tcacctcctg tacaacttca gtcaacgtca atctcccaat tggtgaagag      1500
     ggcgattttg tagagttccc agttcctgag caactcaaac acagctttgc tgatggaaag      1560
     ctgaaaacca ctgtttatga gcatgcaggt tag                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page