(data stored in ACNUC8465 zone)

EMBL: CU928166.PE237

CU928166.PE237       Location/Qualifiers
FT   CDS_pept        479404..480567
FT                   /locus_tag="KLTH0B05808g"
FT                   /old_locus_tag="KLTH-ORF15152"
FT                   /product="KLTH0B05808p"
FT                   /note="weakly similar to uniprot|P53901 Saccharomyces
FT                   cerevisiae YNL152W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21602"
FT                   /db_xref="GOA:C5DCU1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037791"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU1"
FT                   /protein_id="CAR21602.1"
FT                   /translation="MSTVSASAFGGANGLLEVYVSRARDLPNLRKLDKQSPFVRLRISH
FT                   MTETSDVAFRGGQTPKFDYYAKFDLTPDVKPALAVEVFDDRSPPKLIGQCAVDLTPALY
FT                   KDPEDGHDDWFPLSFGSEEAGEIYLELTFHPLIPTSRLQRHRNDGISAFEESLASRPPP
FT                   PLPAKLPSFQLEKRHDEVTHNNTYSHASNLSQTLLSEPERISFGQSVSSKRMPNLDVSV
FT                   ASNSTFASQATNETHESHATVATSGTTEPLFAKLKQLKEKWNSIKNPGKDQQDHDKKVD
FT                   LEALQKVVGVEPEEFNQDERGFRRVTDVSTQASKLVTQPPLPRLPDQSSRRTSIESRAL
FT                   PTSRPNSCINETSPKLPPLPRSPSSRPDLRTRTAPNSPVRRKPPPKW"
     atgtccacag tatctgctag tgcttttgga ggtgctaatg gacttttgga agtttacgtg        60
     agcagagcaa gagacttacc gaatcttaga aagcttgaca agcagagccc tttcgttcga       120
     ttgagaatct cgcacatgac agagacatca gatgttgcat ttcgaggcgg ccagacccct       180
     aagtttgact actatgcaaa atttgacctg actccagatg ttaagcctgc tttggcggtt       240
     gaggtattcg atgatagatc accacctaag ttgattggac agtgcgctgt tgacttgacc       300
     cctgcacttt acaaggaccc agaagatggg cacgacgatt ggttcccatt gtctttcgga       360
     agtgaagagg cgggcgaaat ttacctggaa cttacgttcc atccgcttat accgacctca       420
     aggctgcaaa gacacagaaa tgatggtata agcgccttcg aggaatccct agcgagtagg       480
     cccccgccac ccttgcctgc taagctgccg tcttttcaac ttgaaaagcg ccatgatgaa       540
     gtaacgcaca acaacacgta ttctcatgcc tccaacctaa gtcagacgtt actttccgaa       600
     cccgagagga tctcctttgg tcaaagtgtt tcctcgaaga gaatgcctaa tctggatgtt       660
     tccgttgcct caaacagcac ttttgcatcg caggccacca acgaaacaca tgaaagtcat       720
     gccacagtag caacttcagg aacaacggaa ccgctgtttg caaagctgaa gcaactcaaa       780
     gaaaagtgga attctataaa aaaccccggc aaggatcagc aagaccacga taagaaagtc       840
     gatcttgagg cattacagaa agtggttggg gtggagccgg aggagttcaa tcaggatgaa       900
     cgaggttttc gaagagttac cgatgtctca acgcaagctt cgaaattagt cacgcagcct       960
     cctcttcctc gcttgcctga tcaaagctct cgaagaacca gtatagagag tagagcgcta      1020
     cctacgagtc gaccaaattc atgcatcaat gagacgtctc caaaactccc accacttcca      1080
     agaagcccgt catcaagacc agatcttaga acgagaactg cacctaattc gccagtcagg      1140
     agaaagcctc cacccaaatg gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page