(data stored in ACNUC8465 zone)

EMBL: CU928166.PE238

CU928166.PE238       Location/Qualifiers
FT   CDS_pept        complement(480876..481574)
FT                   /locus_tag="KLTH0B05830g"
FT                   /old_locus_tag="KLTH-ORF15151"
FT                   /product="KLTH0B05830p"
FT                   /note="similar to uniprot|P17890 Saccharomyces cerevisiae
FT                   YNL151C RPC31 RNA polymerase III subunit C31 contains HMG-
FT                   like C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21603"
FT                   /db_xref="GOA:C5DCU2"
FT                   /db_xref="InterPro:IPR024661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU2"
FT                   /protein_id="CAR21603.1"
FT                   /translation="MSFQRGGREGNSFAKNLPFGLSYSDVGVNENTELPSIPLPVNGLV
FT                   TSKERITSLKYMNFIKAVKEGPFYTGSMSLTIDGTGKQKQLVDEDGINDGIERYSDRYL
FT                   KKRKIGVSIDEHPFHLEFFPDELYQVMGINKKKLLALSNLNRQDDVFTGSAKDDDAEGL
FT                   SMLEKLKGLAEDEDETANADGKDDAHEAEDLDDDFGDSDEDDDYNAEKYFDDGDDDAEN
FT                   EDDYGDEPAF"
     atgagtttcc aacgtggtgg gcgcgagggc aattcgtttg ccaaaaactt accttttggg        60
     ctgagctaca gtgatgtcgg agtcaatgag aatacagagc ttccctcgat cccgcttccc       120
     gttaatggct tagtcacgag caaagagcga atcacatctt tgaagtacat gaatttcatt       180
     aaggcggtca aagaaggtcc cttttacact ggttctatgt cgctaactat tgatggcact       240
     ggtaagcaaa agcaactagt ggatgaagac ggtatcaacg atggaattga aagatactcc       300
     gatcgctatt tgaaaaagcg caaaatcggt gtatccatag acgagcatcc ttttcatttg       360
     gagtttttcc cagacgaact ttaccaggtt atgggtataa acaagaagaa gcttcttgcg       420
     ttgtcaaatc tgaatcgcca agacgacgta ttcacaggtt ctgcgaaaga cgacgatgca       480
     gagggcctgt caatgctcga gaagctgaaa gggctcgcgg aggatgaaga tgaaacagca       540
     aatgcagacg gcaaggacga tgcgcatgag gctgaggacc tcgacgacga cttcggcgac       600
     agcgacgagg atgacgacta taatgctgag aaatactttg atgacggcga tgacgatgct       660
     gaaaatgaag atgactacgg cgacgagccc gcattttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page