(data stored in ACNUC8465 zone)

EMBL: CU928166.PE239

CU928166.PE239       Location/Qualifiers
FT   CDS_pept        complement(481757..482137)
FT                   /locus_tag="KLTH0B05852g"
FT                   /old_locus_tag="KLTH-ORF15149"
FT                   /product="KLTH0B05852p"
FT                   /note="weakly similar to uniprot|P53903 Saccharomyces
FT                   cerevisiae YNL149C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21604"
FT                   /db_xref="GOA:C5DCU3"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU3"
FT                   /protein_id="CAR21604.1"
FT                   /translation="MDFFDRAYQNLYDTFAGIDAAHAIRLVIIVGGYLLFRNLTQKHLA
FT                   KKQLEQKLRKSEEAKAAEKQKELIADPQDEETIQDNAFGWGNKTRKRVKRQEKILEERL
FT                   QELEKLQGSQDDDKDIEDLLED"
     atggatttct tcgacagagc ataccagaac ttgtacgata cgttcgctgg cattgacgct        60
     gcccatgcta taagactagt gatcattgtt ggtggatacc tgctctttag aaatttaact       120
     caaaagcatc tcgctaagaa acagctagaa caaaaattgc gtaagtctga ggaggcgaag       180
     gcagcagaga aacaaaaaga gctgattgct gatccacagg acgaagagac cattcaagac       240
     aatgcgttcg gctgggggaa caaaacgcgc aagcgggtga agagacaaga gaagatattg       300
     gaggaaagac tccaggagct ggaaaagcta caaggctcgc aggacgacga caaagacatc       360
     gaagacctat tggaagactg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page