(data stored in ACNUC8465 zone)

EMBL: CU928166.PE240

CU928166.PE240       Location/Qualifiers
FT   CDS_pept        complement(482270..483013)
FT                   /locus_tag="KLTH0B05874g"
FT                   /old_locus_tag="KLTH-ORF15148"
FT                   /product="KLTH0B05874p"
FT                   /note="similar to uniprot|P53904 Saccharomyces cerevisiae
FT                   YNL148C ALF1 alpha-tubulin foldin protein implicated in
FT                   folding of alpha tubulin cofactor B"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21605"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU4"
FT                   /protein_id="CAR21605.1"
FT                   /translation="MPQIQISSPLCSIVRELSPQWSWPQLCDKLSEITGVLPSDMQINV
FT                   IFKDRTSLLINAPLTEQKPLSSLLSKNAVELQVNDSNASSLANELARDFTEGEQSSEQT
FT                   YHLPEEDYQRRQDSVLQWKKDLQLGKFNPEYQARLQKDCEEQQSRAEELTINERCSVST
FT                   PNLPERRGWLRFVGSLTPLMDEPGIWCGVEFDEPVGKNDGSFKGRYFFGPVRPKYGAFV
FT                   KPSTVKTSAKFSPLLDDIEFSDSEI"
     atgccgcaaa tacagatttc ctcacctctg tgctcaatcg tgcgagaact atcgccacaa        60
     tggagctggc ctcaattgtg tgacaagctg tctgagatta caggggttct gccttccgat       120
     atgcaaatca atgtcatctt caaagatcga acctcgctcc ttatcaatgc gccattaact       180
     gaacaaaagc cactatcaag cctactctca aaaaatgctg tggaacttca agtcaatgat       240
     tctaacgctt cctctctcgc caatgagcta gcccgcgatt ttacggaggg cgaacaaagt       300
     tcagagcaga catatcacct ccccgaagaa gattaccaaa gaagacagga ctctgtgctt       360
     caatggaaaa aggacctcca gctaggcaaa tttaatccag agtatcaggc caggctccag       420
     aaggactgcg aggaacagca aagccgcgca gaagagctca ccataaacga gagatgctct       480
     gtttccacac caaaccttcc cgagagaaga ggctggctga ggttcgtggg ctcgttgacg       540
     ccgctaatgg atgaacctgg tatatggtgt ggggtggagt tcgacgaacc agtcggaaag       600
     aacgacggct ctttcaaagg gcgctatttt tttggcccag tgcgaccaaa atacggtgcc       660
     ttcgtcaaac cctcgactgt gaaaacctca gcaaaattta gcccccttct agacgatatt       720
     gagttttctg atagcgagat ttag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page