(data stored in ACNUC8465 zone)

EMBL: CU928166.PE244

CU928166.PE244       Location/Qualifiers
FT   CDS_pept        complement(486413..488239)
FT                   /locus_tag="KLTH0B05962g"
FT                   /old_locus_tag="KLTH-ORF15141"
FT                   /product="KLTH0B05962p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05962g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21609"
FT                   /db_xref="GOA:C5DCU8"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU8"
FT                   /protein_id="CAR21609.1"
FT                   /translation="MSSKRTLKQILDSEYVEGSDEEADGISNAETAADVDDNEEEVDRS
FT                   FCIDCKDMKTEIICKDCEEHFCVVCFDMIHRSGRRKKHEYVKVSLQPEELPANEQEQQA
FT                   LQNSNNVVSEQNPLAGDGAEPGVTQGVNSLDLKMLAMLAKHARFIPMRLAPEERHLLRL
FT                   LEAALNVSEYTDRVDIISYKSKAKRIVEQLKEMCSVLCGLVIASNLRTGQKLLEMKNFS
FT                   DNAAWFQDVFEIGRRYKIMNPEKMRDTYGKLCYMIMDSRLPQIEEHMEFHLFKPLSTVH
FT                   SFLSSKPEDRGQALKIFEDKLILYATSQISPVGKSRPEINRLIKQKEAAIEKLASKYSS
FT                   RYFSKDDIRQVLYSIGDYNAYINMNRRPIMRMLERLEAFNNPTIATQYPIGIQYGRGGA
FT                   RLTHDHARQMHYVQQSLTLWSVIQREMIHLWYIADQDLYNPNEYRLASTGQGLNRIKAC
FT                   PMLYREMHNILSECRSKCDAWVGSSVVHLGDDAVPNALFFLDKYTQVPNILIPFDQALM
FT                   KINELVDNDPKLLEYIEGEYGSTDGLKLTILQDAFAHMFDGSGADNFYMSGSCIDGRLT
FT                   SAWNHTNMISKKKYYKIFLMTGFIGFNGQDGF"
     atgtcatcaa aaagaacttt aaaacaaatc ttggattctg aatacgtcga gggaagtgat        60
     gaagaagcgg atgggatctc gaacgccgag acagccgctg atgttgatga taatgaggaa       120
     gaagtggacc gctcgttttg cattgattgt aaggatatga aaactgagat tatctgcaaa       180
     gactgcgaag aacatttctg cgttgtgtgc tttgacatga ttcatcgcag cggacgcaga       240
     aaaaagcacg aatacgtcaa agttagcctc cagcctgagg agttgccagc taacgaacag       300
     gagcagcaag cgctgcaaaa ctccaataat gtcgttagtg agcagaatcc tctggcaggt       360
     gatggcgccg agcctggtgt cacacaagga gtgaactctc tcgacctgaa aatgctcgca       420
     atgctggcaa aacatgcaag attcattcct atgaggctag cgcctgaaga aagacattta       480
     ctgaggctgc tggaagcggc gttgaatgtc tcagaatata ctgatagagt ggatatcata       540
     tcctacaagt ctaaagcaaa aaggattgtt gagcagctta aagagatgtg ttctgtgctc       600
     tgcggccttg taattgcatc aaatttacga accgggcaga agctgctcga gatgaagaat       660
     tttagtgaca atgctgcatg gtttcaagac gttttcgaga tcgggagacg ttataagatt       720
     atgaatccag agaaaatgag agatacttat ggcaagcttt gctacatgat catggactca       780
     cgtttgcctc aaattgagga acacatggaa ttccacttgt tcaagccttt gagcactgtc       840
     cactctttct tgagctcgaa gcctgaagac cgaggtcaag ccctcaaaat atttgaagat       900
     aagctgattc tatatgccac atcacagatt tccccagttg gaaagtctag accagagatc       960
     aatcgcctta tcaagcaaaa ggaagccgct attgaaaagc tggcttcaaa gtacagcagt      1020
     aggtatttca gcaaagatga catccgccaa gtcctatact ccataggcga ttacaatgca      1080
     tacatcaaca tgaaccggag acccatcatg cgcatgctgg agcgcctgga agccttcaat      1140
     aatccaacaa ttgctaccca gtacccaata ggtatccaat acggaagggg tggggcacgt      1200
     ttaacccatg accacgcacg tcaaatgcac tatgttcaac aatctctaac gctgtggtct      1260
     gtcatacaaa gagaaatgat ccacctgtgg tacatcgctg accaagacct ttacaatccg      1320
     aacgaatatc ggttagcctc aacaggacag ggtcttaacc gcataaaagc gtgtcccatg      1380
     ctatacaggg agatgcataa catcttgagt gaatgtcgct cgaaatgtga cgcttgggtg      1440
     ggctcatccg tagttcatct gggcgacgat gctgttccga atgccttgtt ttttctggac      1500
     aaatatacgc aagtacctaa tatcttgatc ccattcgacc aggcactaat gaagatcaat      1560
     gaacttgttg ataatgatcc caaacttttg gaatatatcg aaggagagta cggttccact      1620
     gacgggttga agctgacaat tcttcaagat gcattcgcgc atatgttcga tggttctggc      1680
     gcagataact tctatatgag cggatcgtgt attgatggaa gattgacatc tgcttggaac      1740
     cacactaaca tgatatccaa gaaaaagtac tataagatat tcttgatgac cggctttatt      1800
     ggtttcaatg gccaagacgg cttttaa                                          1827
//

If you have problems or comments...

PBIL Back to PBIL home page