(data stored in SCRATCH zone)

EMBL: CU928166.PE246

CU928166.PE246       Location/Qualifiers
FT   CDS_pept        complement(492629..493867)
FT                   /locus_tag="KLTH0B06006g"
FT                   /old_locus_tag="KLTH-ORF15130"
FT                   /product="KLTH0B06006p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06006g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21611"
FT                   /db_xref="GOA:C5DCV0"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV0"
FT                   /protein_id="CAR21611.1"
FT                   /translation="MLMRSVLFSLACANAVLASGTTVLEEDLEQMWGQDWPFSGIQTFA
FT                   HLPHEKCLMNRSLDFDIGVIGIPFDTAVTYRPGARFGPQAIRKSSQRQTSMRGFNFRAG
FT                   INPYQDWAKVLDCGDVPVTPMDNNLALQMMGAAYHNLLNRNSTLKQAELPPRFATLGGD
FT                   HSIILPILRQLHKIYGPISVIHFDSHLDTWAPSKYPSYWHSNNSDFTHGSMLWIAKQEG
FT                   LLSENSNVHAGLRTRLSGVGWDDYEEDKETGFHRIECDEILDIGVRGIARKILDIVPKD
FT                   KPVYISVDIDVLDPSAAPGTGTVEVGGLLTRELISIIRQLDGLSLIGADVVEVSPAYDQ
FT                   SDITSTAASQIVYELITNMVKKGPLDPAMIQANKNSEMDQGDKPQNLAENEYQSLGEGA
FT                   RQNFMESLLQGRV"
     atgttgatgc gttcagtgct cttttccctt gcgtgcgcaa acgcggtgct cgcctctgga        60
     actacagtgt tagaggaaga cttggagcag atgtggggcc aagactggcc gttctcgggt       120
     attcagacct ttgcacatct gccacacgaa aaatgcctta tgaacagaag tcttgatttc       180
     gacattggtg taattggaat acctttcgat accgcggtca cgtataggcc gggcgcaaga       240
     tttggtccac aggcaattag gaaatcttca caaagacaaa cctctatgag gggcttcaac       300
     ttcagggctg gtatcaaccc ttaccaagac tgggccaagg ttttggattg tggcgacgtt       360
     ccagtaaccc caatggacaa caacttggcc ttgcagatga tgggtgctgc ttatcacaat       420
     ctcctgaata gaaatagcac attgaagcaa gcggaacttc cacctaggtt tgcaacgctt       480
     ggtggtgacc acagtatcat cttgcctatc ttgcgtcagc ttcacaaaat atacggtcca       540
     atctctgtta ttcattttga ttctcacctg gatacatggg caccatctaa atatccatct       600
     tactggcaca gtaacaactc cgatttcacg catgggtcta tgttgtggat agccaagcaa       660
     gaaggccttc tctctgaaaa ctcgaacgtt cacgctggcc tcagaacgcg tctgagcgga       720
     gtggggtggg acgattacga agaggacaag gagaccggct ttcaccggat tgaatgcgat       780
     gagattctgg acattggcgt gagaggaata gccaggaaaa tattagatat tgtccccaaa       840
     gacaaaccag tgtatatcag tgtcgacatt gatgttttgg atccaagtgc tgctccaggt       900
     accggaacag tggaagttgg tggcttgctc actcgtgaac ttattagcat tatccggcaa       960
     cttgatggct tatctttgat tggcgcggac gtcgtagagg tttcccctgc atatgaccaa      1020
     agcgacatca catctacggc agcatcccaa attgtttacg aactcattac aaacatggtc      1080
     aaaaaaggcc ctcttgatcc cgcaatgata caggcaaaca aaaacagcga gatggatcag      1140
     ggcgacaaac ctcaaaattt ggctgaaaac gagtaccaaa gccttggaga aggtgctcga      1200
     cagaatttca tggaatccct ccttcaaggg agagtctaa                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page