(data stored in SCRATCH zone)

EMBL: CU928166.PE247

CU928166.PE247       Location/Qualifiers
FT   CDS_pept        complement(494230..495027)
FT                   /locus_tag="KLTH0B06028g"
FT                   /old_locus_tag="KLTH-ORF15128"
FT                   /product="KLTH0B06028p"
FT                   /note="some similarities with uniprot|P53895 Saccharomyces
FT                   cerevisiae YNL159C ASI2 Predicted membrane protein genetic
FT                   interactions suggest a role in negative regulation of amino
FT                   acid uptake"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06028g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21612"
FT                   /db_xref="GOA:C5DCV1"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV1"
FT                   /protein_id="CAR21612.1"
FT                   /translation="MTFFMLQKDNANCFKDLDQVLQIKTKSKVKTSCESKKECQGQPIE
FT                   EKMSEDLMHSLQNQNRQQRRAAAMRANPPFRVRVGPRHRQENPFRWPPGVQRRQYLRLF
FT                   LQNLLILDHLLMMVLFPFSVYNVLKILLTEVTFSNSDFVTDIASYCKFSSILSEDGRSV
FT                   ILFKSGFGLLGKFHNIIVYYSAPLFAWLSSNSSVSSFVMRTYTLVVKFTAVVLYTLYGV
FT                   SASTYVCFATFFFSLCLLMTCFRRYKGVAKIVGQLYRTTSGIF"
     atgactttct ttatgttaca aaaggataat gcgaattgtt ttaaagatct agatcaagtg        60
     cttcaaatta agacaaagtc aaaagttaag accagctgtg aaagcaagaa ggaatgccaa       120
     gggcaaccca tagaggagaa aatgagtgaa gacttaatgc atagtcttca gaaccaaaat       180
     agacagcagc ggcgtgctgc tgcaatgcgt gccaatcctc cctttcgcgt tcgcgtaggt       240
     ccgcgacaca gacaagaaaa tccgttccgc tggccacctg gtgtacaaag gagacaatac       300
     ctcaggctct ttctgcagaa tctgcttatc cttgaccact tattgatgat ggttttgttc       360
     cccttttctg tttacaacgt acttaaaatc ctattaacag aggtgacgtt ctcaaacagc       420
     gactttgtaa cggacattgc ctcctactgt aagttttcaa gcattttgag cgaagatggg       480
     agatcagtga tattgttcaa aagtggtttt gggttgctgg gcaaattcca taatatcata       540
     gtatattatt ccgctccatt atttgcgtgg ctatcgtcaa attcaagcgt tagctcattc       600
     gtgatgcgta cttacacgct tgttgtgaaa ttcactgcag tggtgctata cacgctatac       660
     ggggtaagtg caagcactta tgtttgcttt gcgacgttct tcttctcatt gtgcctgctg       720
     atgacttgtt ttagacgcta caaaggcgtt gcaaaaattg taggccaact atatcgtact       780
     accagcggaa tattctaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page