(data stored in SCRATCH zone)

EMBL: CU928166.PE248

CU928166.PE248       Location/Qualifiers
FT   CDS_pept        495028..495585
FT                   /locus_tag="KLTH0B06050g"
FT                   /old_locus_tag="KLTH-ORF15127"
FT                   /product="KLTH0B06050p"
FT                   /note="weakly similar to uniprot|P53896 Saccharomyces
FT                   cerevisiae YNL158W Essential protein of unknown function
FT                   green fluorescent protein (GFP)-fusion protein localizes to
FT                   the nuclear periphery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21613"
FT                   /db_xref="GOA:C5DCV2"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV2"
FT                   /protein_id="CAR21613.1"
FT                   /translation="MRIVPFFAALAFYICFSLANTESIVFKVPDTFSPAPQPIADENEP
FT                   LISLEGTNRALKTFDAPVDSQFDIELRDLSPGDTFFAKICWTAVDPIDITSLGYSIKPD
FT                   YTARGGHWQDAPLRFFLSFEAKSNSYPLFSKPTVPINISVSAMRMGVPVDLHATIIFMT
FT                   LLTGLIFIINRHYKLYNRFKNV"
     atgagaattg taccattttt cgctgctttg gcattctata tatgcttttc ccttgcaaac        60
     acagagtcga tagtctttaa ggtgccggat acgttttcac ctgcgcccca gccaatcgcc       120
     gatgagaatg agccattgat ttcgctagag ggaaccaaca gagcactgaa gacattcgat       180
     gcccctgttg actctcaatt tgacatcgag ttaagggatc tatctcctgg agacaccttt       240
     tttgccaaaa tatgttggac agcagtagat cctatagaca tcacttcttt gggctactct       300
     ataaaaccag actatacagc gaggggcggg cattggcaag atgcgccttt aaggtttttc       360
     ctttcttttg aggccaaatc aaactcatat cctctttttt ccaaacccac ggtccctata       420
     aacatctcag tctcggccat gcggatgggc gtgccagtag acttgcatgc cacaatcata       480
     ttcatgacat tactgaccgg gttaatattt attatcaatc ggcattacaa gctttataat       540
     cgctttaaaa acgtttga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page