(data stored in ACNUC8465 zone)

EMBL: CU928166.PE25

CU928166.PE25        Location/Qualifiers
FT   CDS_pept        73357..74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /old_locus_tag="KLTH-ORF15899"
FT                   /product="KLTH0B00836p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00836g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21390"
FT                   /db_xref="GOA:C5DC79"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC79"
FT                   /protein_id="CAR21390.1"
FT                   /translation="MSSNLSTAPEEGKKVYATRSRDSGTSESIAALPEAMQQTTKYSSE
FT                   TPLLILENESEHDIQYKTCSWVHTSGLMLSEYIVLAIMSFPWSYSVLGIVPGIILTLFV
FT                   ASTVLYTGLTIIDYCERFPHLKNVCDIGQHLFWGQKWAWYATLVCFLANNTLIQGLHVL
FT                   VGAKYLNTVTDHSLCTVKFGVIVACISFVVSVPRTFSSLSKVAYFSAATMFIAVVLAMI
FT                   FAGVQDHPYGYDGTPVTFRAFPEKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMQRPA
FT                   EFRKVLYIVTTCEIVIFTLAGVIIYVYVGNEYMSAPAFGSLTRTFKIIAFSFAVPTIIF
FT                   AGSLYSNVSGRLLFFTFFKRSKHLYSHTTVGWLTWIGILALTWVGAFIIAEVVPFFSDL
FT                   LSLMSSLFDCWFGFVFWGMAYFKLKEAKYQNPRYYSQLTASEKFHFFIAIFLIAVGLFI
FT                   LGPGLYAAIDSIILNYQDDAYGTVFSCASNGS"
     atgagcagca acctgagtac agctcctgaa gagggaaaaa aggtgtatgc gacgaggtcg        60
     agggactcag gcacgtcgga aagcatcgcc gcgctgccgg aagccatgca gcaaactacg       120
     aaatactcca gcgagactcc gctgttgatt ctggagaacg agagcgagca cgacatccag       180
     tacaagacgt gctcgtgggt gcacacgtcg gggctgatgc tctccgagta tatcgtcctg       240
     gcaatcatgt cgtttccctg gtcgtactcg gtcctgggaa tcgtgcccgg gattatcctt       300
     acgctcttcg tcgcgtcgac ggtgctctac actggcctca caatcatcga ctattgcgag       360
     aggtttccac acttgaaaaa cgtgtgcgac atcggacagc acctgttctg gggccagaag       420
     tgggcgtggt acgcaacact agtgtgtttc ttagccaata acactttaat tcagggcctg       480
     cacgtgctgg tcggggctaa gtatctcaac acggtcaccg accactcgct gtgtactgtc       540
     aagttcggcg tcattgtggc gtgcatctcg ttcgtggttt ccgtaccgcg gactttctct       600
     tcgctttcaa aggtcgccta cttctctgcc gccactatgt tcatcgcggt tgtcctagcc       660
     atgatcttcg caggcgttca agaccatccc tacggctacg acgggacccc ggtgactttt       720
     cgtgccttcc ccgaaaaggg caccaccttt gtgcagggca tgggcgcttt tctaaatata       780
     gtgtacactt ttgtgggcca gatcacatac ccacagttca tctccgagat gcagaggccc       840
     gccgagttca gaaaagtcct gtacatcgtg accacgtgcg agatcgtgat tttcaccctg       900
     gcaggtgtta tcatctatgt ctacgtcggc aacgagtaca tgagtgcccc ggcgtttgga       960
     tcgttgacga ggactttcaa aattatcgcc ttctctttcg ccgtccccac aattattttc      1020
     gcgggttcgt tatactcaaa tgtctccggc cgtctcttat tcttcacctt cttcaagcgc      1080
     tctaagcact tgtactcgca tactacggtg ggctggctca cctggattgg gattctggct      1140
     ctaacatggg ttggtgcctt tatcatcgct gaggtcgttc ccttcttctc ggatctgctc      1200
     tccctcatgt cttctctctt cgactgttgg tttggcttcg tgttctgggg tatggcatac      1260
     ttcaagctca aggaagcgaa gtaccagaat ccacgttatt attcacagtt gaccgcttca      1320
     gagaagtttc atttcttcat tgccatattt ctgattgcgg ttgggctctt catcctgggc      1380
     ccaggtctct acgcggccat cgacagcatt atcctgaact atcaggacga tgcctacgga      1440
     actgtgttca gttgtgcatc aaacggcagc taa                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page