(data stored in SCRATCH zone)

EMBL: CU928166.PE251

CU928166.PE251       Location/Qualifiers
FT   CDS_pept        complement(497825..498613)
FT                   /locus_tag="KLTH0B06116g"
FT                   /old_locus_tag="KLTH-ORF15122"
FT                   /product="KLTH0B06116p"
FT                   /note="similar to uniprot|P53898 Saccharomyces cerevisiae
FT                   YNL156C NSG2 Protein of unknown function potential homolog
FT                   of mammalian Insig 1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06116g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21616"
FT                   /db_xref="GOA:C5DCV5"
FT                   /db_xref="InterPro:IPR025929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCV5"
FT                   /protein_id="CAR21616.1"
FT                   /translation="MARKKAQMANGNYSVSSESISNLTRPQLYGIYDADITHSEDAEVY
FT                   EEAKKSVGKFPEDMIKRSGAHGQRSMLQRATHILFSLTFLGVAGISYNELSKQLHDNHE
FT                   LHEEFASRPLALGVEICRTLSFGVVPTWMAYALEGVLFGALLPLMDTLWGSPVRTTTFT
FT                   SFLRSTNAMLGVAFGIRKIEWSSSLQASGAWFLLNIVLWMFFDGTPSMLLGCLGIGTIA
FT                   SVTSYRDVTEFSQMLYFMDFYFLGLLLFGKLGRYLYGHRA"
     atggctagaa agaaggccca gatggccaat ggaaactaca gcgttagcag tgagtccatc        60
     agcaatctta cacgaccaca gctgtacggc atctacgatg cagacatcac tcacagcgaa       120
     gatgctgaag tctacgaaga agccaaaaaa tcggtaggaa aattcccaga agacatgatc       180
     aagcgctccg gagcccacgg ccaaaggtcc atgctccaga gagcaactca catactgttt       240
     tcgttgacat ttcttggcgt tgcaggcatt tcatacaacg agctcagcaa gcagcttcac       300
     gacaaccacg agctgcacga agagtttgca tcgaggcctt tggctttagg cgtagagatt       360
     tgccggactc tgagctttgg agtggttcca acttggatgg cttacgcact cgagggtgtg       420
     ctgtttggag cactgttgcc actcatggac acgctgtggg gcagccccgt taggaccacc       480
     actttcactt catttttgcg ctccaccaat gcgatgcttg gcgtcgcgtt cggcattcgg       540
     aaaatcgaat ggagctcttc tctccaggcc agcggcgctt ggtttctcct aaacatcgtg       600
     ctttggatgt tttttgatgg cacgccatcc atgctgctag gctgcctcgg gattggtacg       660
     atcgcctctg tcaccagcta ccgtgacgtg acggagttct cccaaatgct gtactttatg       720
     gacttttatt tcctcggact gttgctgttt ggtaagctgg gcagatactt gtacggccat       780
     cgcgcttga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page