(data stored in ACNUC8465 zone)

EMBL: CU928166.PE266

CU928166.PE266       Location/Qualifiers
FT   CDS_pept        complement(join(520647..520963,521299..521302))
FT                   /locus_tag="KLTH0B06446g"
FT                   /old_locus_tag="Klth0B.mRNA.1227.m"
FT                   /product="KLTH0B06446p"
FT                   /note="highly similar to uniprot|P02405 Saccharomyces
FT                   cerevisiae YHR141C RPL42B and highly similar to
FT                   uniprot|P02405 Saccharomyces cerevisiae YNL162W RPL42A
FT                   Proteins component of the large (60S) ribosomal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06446g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21631"
FT                   /db_xref="GOA:C5DCX0"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX0"
FT                   /protein_id="CAR21631.1"
FT                   /translation="MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDR
FT                   KQRGFGGQTRPIFHKKAKVTKKVVLRLECVVCKTRAQLALKRCKHFELGGEKKQKGQAL
FT                   QF"
     atggttaacg ttccaaagac cagaaggacc tactgcaagg gcaagcaatg ccgcaagcac        60
     acccaacaca aggtcaccca atacaaggcc ggtaaggctt ctttgtacgc tcagggtaag       120
     agacgttacg accgtaagca gcgcggtttc ggtggtcaga ccagacctat cttccacaag       180
     aaagccaagg ttaccaagaa ggttgtcttg agattggaat gtgtcgtctg caagaccaga       240
     gcccagctgg ctttgaagag atgtaagcac ttcgaattgg gtggtgagaa gaagcagaag       300
     ggccaagctt tgcaatttta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page