(data stored in ACNUC8465 zone)

EMBL: CU928166.PE271

CU928166.PE271       Location/Qualifiers
FT   CDS_pept        528699..529601
FT                   /locus_tag="KLTH0B06556g"
FT                   /old_locus_tag="KLTH-ORF15056"
FT                   /product="KLTH0B06556p"
FT                   /note="some similarities with uniprot|P38844 Saccharomyces
FT                   cerevisiae YHR143W DSE2 daughter-specific expression
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21636"
FT                   /db_xref="InterPro:IPR026225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX5"
FT                   /protein_id="CAR21636.1"
FT                   /translation="MQFKLSTIATALTFLSSMVCADSNVRYITSDGVVYSFAVITSTIK
FT                   PATTYVTTRYYTTTEVVPVTLSNQVVSSSTKAVTKTSTLEVVSSTAPAESSSLTPESTS
FT                   TLSSSQQPDTTSSQSQSSNTRSTLSTAIQSSSAASASSTFSLISSSIPASSSPRSTFVS
FT                   STDVSSSVSSATYSASSASSSSSSSAIASSTSSAFSSTSNTPGISSSSASATSASSASK
FT                   SSSTITKSSPSVTSIASSTLSLEGEAFTTEYDEDGSCTVYYEDDDDYYTTVYLTDSSQS
FT                   VDAYTTYTSTRTVYETIST"
     atgcaattca aactttccac aatcgctact gctttaactt ttctatcctc gatggtatgc        60
     gccgattcca atgtgagata tatcacatct gatggcgtgg tttacagctt tgccgttatc       120
     actagcacca tcaagcctgc tactacttac gtgaccacca ggtattatac cactaccgag       180
     gtggtgcctg tgacattgtc caatcaagtt gtttcttcgt ccacaaaggc tgtgaccaag       240
     acttcaacct tggaagtggt cagcagcacg gcacctgccg agtcgtctag cctgacgcca       300
     gaaagcacgt caacgctttc ctccagccag cagcccgata caacgtcttc acagtcgcag       360
     tcctctaata cccgctcgac actatcaacc gccatccaaa gttcttcggc tgctagtgcc       420
     tcaagcacct tttctttgat atcttcatct atcccagcta gctcgtcccc tcgctcgacc       480
     ttcgttagct caactgatgt ttcttctagc gtctcctcag cgacctattc tgcatcaagt       540
     gcttctagtt cttcctcttc cagtgctatt gcctcctcaa cctcaagtgc tttcagttcc       600
     acttcaaata ctcctggtat ctcctcttct agtgcttctg ctacttctgc atcaagtgct       660
     tccaagtcgt cctccaccat caccaagtct agcccatccg ttacttctat tgcttcttca       720
     acgctctccc tggaaggaga ggctttcaca accgagtatg acgaggatgg atcgtgcaca       780
     gtctactacg aagatgacga cgattattac acaacggtat acttgaccga ctcaagccag       840
     tccgtggatg cttacacaac atacaccagc acaagaacag tttacgaaac gatatcaaca       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page