(data stored in SCRATCH zone)

EMBL: CU928166.PE273

CU928166.PE273       Location/Qualifiers
FT   CDS_pept        531018..532247
FT                   /locus_tag="KLTH0B06600g"
FT                   /old_locus_tag="KLTH-ORF15052"
FT                   /product="KLTH0B06600p"
FT                   /note="weakly similar to uniprot|P53890 Saccharomyces
FT                   cerevisiae YNL166C BNI5 Protein involved in organization of
FT                   septins at the mother-bud neck may interact directly with
FT                   the Cdc11p septin localizes to bud neck in a septin-
FT                   dependent manner"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21638"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX7"
FT                   /protein_id="CAR21638.1"
FT                   /translation="MDQETLRKRMSQIELEIDEMNQVIDENLQLAEPHGDEPPEHEKKK
FT                   RWDSGTSKDPETGPEEPETQQVIEAELFLRSATRPVPPSIPAATELGKEQRTKPALENE
FT                   PTHSEHMNQPPAERVPLEQTPSDGGVSLAPSQYVDAPEAVPAQSSSKSEAAPADIGLRE
FT                   TQPLNGISSRQAGSVGSAGSPRESQPSTETAETPSSEVDREQPDEHLQPPSEEFTTTAS
FT                   RGFKAASREDARKEMPQQSTLGNNEPQEASAGMSFDENSPSTQSSAGSKQPVSPDSTQS
FT                   SPQLNLPKTRNPAFPGKRATSNPNPFRVVSVTSKQTEDVSPAQKLQTRHDYLARKCIKL
FT                   QREIQYLSDLRDRGAVAPEDARKINSALEKLQEYLDLKTKERYEIGVLLSRQLRREIDR
FT                   GENGQFWVGH"
     atggaccagg aaacgctgcg gaagcgaatg tcacaaattg agctggaaat cgatgagatg        60
     aatcaagtta ttgacgagaa tctccagcta gcagagccgc atggggacga gccgcccgag       120
     catgaaaaga agaagagatg ggacagcggc actagcaagg acccggaaac tggaccggaa       180
     gagcccgaaa cgcagcaggt catcgaagcc gaactgtttt tgcggtctgc gactcggcca       240
     gtgcctccct cgatacccgc tgctacggag ctcgggaagg agcagcgcac aaagcctgcg       300
     ctggagaacg agcccacgca ttcggaacat atgaaccagc cgccagctga gcgcgtaccg       360
     ttggaacaaa cgccttccga tggtggagtg tctctagcgc catcgcaata cgtcgatgca       420
     ccagaggctg ttccggcgca atcatcttct aaaagcgagg ctgcacccgc tgatatagga       480
     cttagagaaa cacagccctt aaacggtatc tcctcccgcc aggcaggctc tgttggctct       540
     gcgggctcgc cgcgcgagtc gcaaccttcg acagaaaccg cagaaacgcc ctcgagcgaa       600
     gtggacagag aacagccaga tgaacatcta caaccaccct ctgaagaatt tactacgacg       660
     gcatctcgtg ggttcaaggc tgcgtcaagg gaggatgccc gcaaggaaat gccgcagcaa       720
     agcactcttg gcaacaatga accacaggag gctagtgccg gcatgtcctt tgatgagaac       780
     agtccgtcga cgcagtcaag cgcgggatcc aagcaaccgg tgagccctga ctccactcag       840
     tcgtccccac aactgaacct gcccaaaaca agaaaccccg cattccccgg aaagcgcgct       900
     acttctaacc ccaatccctt cagagtcgtt tctgtcacaa gcaagcagac tgaagacgtc       960
     tctccagcgc agaaactaca aacacgccac gactaccttg cccgcaagtg catcaaactt      1020
     caacgcgaga tacagtatct gagcgatctg cgcgatcgtg gagccgtggc tccagaagat      1080
     gcgcgtaaga ttaactctgc gctagagaag ctacaagaat acctcgacct caagactaaa      1140
     gagcgctacg aaataggtgt cttgctgagt agacagctgc ggcgtgagat cgaccgcggc      1200
     gagaacggtc agttctgggt cggtcattag                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page