(data stored in SCRATCH zone)

EMBL: CU928166.PE275

CU928166.PE275       Location/Qualifiers
FT   CDS_pept        537899..538249
FT                   /locus_tag="KLTH0B06688g"
FT                   /old_locus_tag="KLTH-ORF15039"
FT                   /product="KLTH0B06688p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21640"
FT                   /db_xref="GOA:C5DCX9"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCX9"
FT                   /protein_id="CAR21640.1"
FT                   /translation="MVSPVITIFRIVLAMALSNLFLGFVLFSPLRDNGLGASDLMDLWT
FT                   TIAAVEPRGDTRGWDRIASYINEYLITNGAPGRLAQFYDGEDCIQRFKKRYSASLLKKK
FT                   RRGGGKFEDLRS"
     atggttagcc cagttatcac aatctttcgc attgtacttg ccatggcgct aagcaatctt        60
     tttttggggt ttgtgctttt ctcccctctt agggataacg gcttgggagc ttctgatctt       120
     atggacctat ggaccaccat tgctgctgtt gaaccccgtg gagatacaag aggttgggac       180
     cgcattgcaa gctatataaa cgaatacctg atcactaatg gtgcacctgg tcgcctagcg       240
     cagttctacg acggtgaaga ctgcatacag aggttcaaga agaggtattc tgcgtcccta       300
     ctcaaaaaga agcggcgggg aggcggtaag tttgaagacc tgcggtccta a                351
//

If you have problems or comments...

PBIL Back to PBIL home page