(data stored in SCRATCH zone)

EMBL: CU928166.PE276

CU928166.PE276       Location/Qualifiers
FT   CDS_pept        538970..540142
FT                   /locus_tag="KLTH0B06710g"
FT                   /old_locus_tag="KLTH-ORF15038"
FT                   /product="KLTH0B06710p"
FT                   /note="weakly similar to uniprot|P38723 Saccharomyces
FT                   cerevisiae YHL048W COS8 Nuclear membrane protein member of
FT                   a family of conserved often subtelomerically-encoded
FT                   proteins regulation suggests a potential role in the
FT                   unfolded protein response"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06710g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21641"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY0"
FT                   /protein_id="CAR21641.1"
FT                   /translation="MRGTFKEDPEAHELRNPKTHYRNKASWELAQMATGLSIPKWMSSG
FT                   LIICMFIAAHDVYYERAPARSWHRQQLYNVLLSSFAMLFESPYQKIKRTIKLQMEQLCR
FT                   EVLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFRKLVVHPVNKKL
FT                   LATRVQRATVDAREGELSTRTSAASEPAKDTIACYESGMREWWARNAKPEKQEGIDVAC
FT                   RKLPKEVVWSKVGWQFSVAMAALVQTRAFIPISFLSFIGLGTVYSIDTIFRLTPVVLSN
FT                   VFWGIILSPALRDTDVNARDLMELWATIVAVEPRGDTSEWDRVASHMNKYLVTASAAGR
FT                   AAQFYDGENCMQRFKKWYSASLLPKEGQVDARFEDLQPYIEAAMDAASED"
     atgagaggaa ctttcaaaga ggaccctgag gctcatgaat tgcgaaaccc gaaaacacac        60
     tatagaaaca aggcctcatg ggagctggcg caaatggcta cagggctctc catacccaag       120
     tggatgtctt cagggttgat catctgtatg tttattgcgg ctcatgatgt atattacgaa       180
     cgcgcacctg caagatcatg gcaccgtcaa cagttgtaca atgtcctcct gtccagtttt       240
     gcgatgctct ttgagtcacc ttaccaaaag atcaaacgga ctattaagct tcagatggag       300
     cagttatgca gagaggttct tgagggaaat cccgggatgc agatcgaaca gtgggatttg       360
     gtggcacagc ggctcaacga ctttttgcac gctgagggac attggcccgt taccaatcct       420
     ttattcgacg ggcacatgtg tcactccctg ttcagaaagt tggtagttca tcctgtaaac       480
     aagaagcttc ttgcaacgcg agtccagcgc gcgacggtgg atgcgcgaga aggagagctg       540
     tcaacacgca catctgcagc tagtgagccc gcaaaagata ccatcgcatg ctatgagagc       600
     ggtatgcgcg agtggtgggc taggaacgcc aaacctgaga aacaggaagg tattgatgtc       660
     gcgtgcagga aactcccgaa ggaagtcgtt tggagcaagg ttggatggca gttctctgtg       720
     gctatggctg ctctcgtcca aactagggca ttcataccta tttcatttct gagtttcata       780
     gggcttggaa cggtttactc aatcgacaca atatttcgcc ttacccccgt ggtgctgagc       840
     aatgtctttt ggggaattat actttctccc gctttaaggg atactgacgt aaacgcccgt       900
     gatctcatgg agctgtgggc cactattgtt gccgttgagc ctcgcggaga taccagcgag       960
     tgggaccgcg ttgcaagcca catgaacaag tacctggtta ccgctagtgc agcaggccgt      1020
     gcagcgcagt tctacgacgg tgaaaactgt atgcagaggt tcaagaagtg gtattccgcg      1080
     tcgctgctcc caaaggaggg gcaggtcgat gccaggttcg aggacctgca gccctatata      1140
     gaagcggcca tggacgctgc cagtgaggac taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page