(data stored in ACNUC8465 zone)

EMBL: CU928166.PE277

CU928166.PE277       Location/Qualifiers
FT   CDS_pept        541428..543518
FT                   /locus_tag="KLTH0B06732g"
FT                   /old_locus_tag="KLTH-ORF15034"
FT                   /product="KLTH0B06732p"
FT                   /note="some similarities with uniprot|Q02100 Saccharomyces
FT                   cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
FT                   transcription factor of the ATF/CREB family that forms a
FT                   complex with Tup1p and Ssn6p to both activate and repress
FT                   transcription cytosolic and nuclear protein involved in the
FT                   osmotic and oxidative stress responses"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06732g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21642"
FT                   /db_xref="GOA:C5DCY1"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY1"
FT                   /protein_id="CAR21642.1"
FT                   /translation="MNECQTGTALQRKCHAHSYWLRHTLALITRSSSPTGQLGTYCSAK
FT                   HVPASTVLSSSARTDYRVAPERAQLSATRSSLPAARAQETVAATYRQAQPVTSPSAMRA
FT                   SDPPANDASLVSSFDLEPNPFEQSFASSDKPHGAGGAGVAGHQQVQRARQQSQSQSQSQ
FT                   PQSQPQSQPQLQGQSQQPTPSQPTLPSVHSAQSAASAQPKLPVIPTTPGGSRRLPPLLL
FT                   ANPAPAPATATTAVTATNALATPSAPQHGASAGGSQQAPQVPQASAGSATPGFFINLSK
FT                   TGLTPNESGLRTGLTPGILTAAAPPHPPPPVSLPSGQFTPGLSSLLGLPLGQQPGQQQQ
FT                   AAQQPQQPQQTQQVSQQPAQQQQQQQQQQQQQQQQQQQQQQLPPHPAMSWSHSSSTAVS
FT                   SDPSTTSSQNVKPRNNTSSSSSSSLAQDGTSALSLSEPAQKRQKLSSALPAKKPKNSEP
FT                   SPLDVKDEQERKRKEFLERNRVAASKFRKRKKEYIKKIESDLQFYEAEYDDLSQCMDKL
FT                   CGISKQTINSSLVGMLKQALLRHDVTSSLTVCNHIEQVLLQTKYVQRGGRNPRREEEEK
FT                   RRMESPDADINSDSTYPRRASLATASTDGYHTSQLQPHQLQSHIRPDAGPQLSAADHAT
FT                   GTINNLPLVINGNTLLGLGDIQDPSHNAGAGTVTMSRPTSLTSLQPENNRSVPLHEYPN
FT                   SN"
     atgaacgagt gccaaacagg tacagcactg cagagaaagt gtcacgctca ttcgtactgg        60
     ctcagacaca cgctcgcgct catcacacgc tcaagttcac ccaccggcca gctggggaca       120
     tattgcagtg cgaaacacgt tcctgcatct accgttttgt cgtctagtgc acgcaccgat       180
     tacagagtcg caccagagcg agcgcagctg tcagccacga gaagttcgct acccgccgcc       240
     cgagcgcagg agaccgtggc agctacgtac cgccaggcac agcccgtcac cagtccgtcc       300
     gcgatgcgcg cgtccgaccc ccccgcgaat gacgcgtccc tggtctcgtc ttttgacctc       360
     gagcccaacc cgtttgagca gagcttcgcg tccagcgaca agccgcacgg tgccggcggc       420
     gccggcgtcg ctgggcacca gcaagtgcag cgtgcgcgcc agcagtcgca gtctcagtcg       480
     cagtcgcaac cgcagtcgca accgcaatca cagccgcagt tgcagggcca gagccagcag       540
     cccacgcctt cgcagcctac gttgccctct gtccattccg cccagtccgc ggcatccgcc       600
     cagcccaagc tccctgtgat ccccacgacg cccggcggat ccagaagatt gcccccactt       660
     cttctcgcga acccggcgcc cgcgcccgca accgcgacga ccgcagtcac agccaccaac       720
     gcgctggcca caccgagtgc gccccagcac ggcgcctcgg ctggagggtc tcagcaggcc       780
     cctcaagtcc cgcaggcgtc tgccggctcc gcaactcctg gcttctttat caatctatca       840
     aagaccggtc tgacgccaaa cgagtctggc ctccggacag gcctcacccc aggtattttg       900
     acggccgcgg cgccacctca cccgcctccg ccggtgtcat tgccttcggg tcagtttacg       960
     ccgggtctct cttctctgct cggcctccct ctgggccagc agccaggcca acagcagcag      1020
     gccgcgcaac agcctcaaca gcctcagcaa actcagcagg tatctcagca gcctgcacag      1080
     cagcaacaac aacagcagca acaacagcag caacaacagc agcaacaaca gcagcagcag      1140
     cagctcccac cacatcctgc aatgtcgtgg agtcattctt cttccactgc ggtgagctca      1200
     gatccctcta ccacttctag tcagaacgtg aaacctagga acaacacatc ctcgtcgtcc      1260
     tcgagcagcc ttgctcaaga tgggacaagc gctctgtccc tcagtgagcc tgcgcagaag      1320
     cgtcaaaagc tgagctctgc gctacctgct aagaaaccta aaaactcgga gccctcgccg      1380
     ctcgacgtca aagacgaaca agagcgcaag cgcaaggagt tcctcgaacg caaccgcgtt      1440
     gccgcatcaa agttccgcaa gcgtaagaag gagtatatca aaaagattga aagcgacctg      1500
     caattctacg aagccgagta cgacgaccta agtcaatgca tggacaagct ctgtggtatc      1560
     tcgaaacaga ccatcaattc tagtctcgtt ggcatgctta aacaggccct tttgcgccac      1620
     gacgtgacct cctcactcac tgtctgcaat cacattgaac aggtgctttt gcaaacgaag      1680
     tacgtgcagc ggggtggtcg aaaccccagg cgtgaggagg aagagaagag gcgtatggaa      1740
     agccctgacg ctgatatcaa ctcagattcc acctatccgc ggcgcgcctc tttggctacc      1800
     gcgtccacag atggctacca cacttcgcag ctgcaaccgc accaactgca gtctcacatc      1860
     aggcccgacg cgggcccgca acttagtgct gccgaccacg ccacgggcac tataaacaac      1920
     ctgcctcttg tcatcaacgg taatactctc ctgggtcttg gcgacattca ggatccttca      1980
     cacaacgctg gagcaggcac agtcaccatg agtaggccca cctccctcac cagccttcaa      2040
     ccagaaaata accggtcggt gcctttgcat gaatatccca attccaacta a               2091
//

If you have problems or comments...

PBIL Back to PBIL home page