(data stored in SCRATCH zone)

EMBL: CU928166.PE281

CU928166.PE281       Location/Qualifiers
FT   CDS_pept        complement(547625..552751)
FT                   /locus_tag="KLTH0B06820g"
FT                   /old_locus_tag="KLTH-ORF15026"
FT                   /product="KLTH0B06820p"
FT                   /note="similar to uniprot|P53886 Saccharomyces cerevisiae
FT                   YNL172W APC1 Largest subunit of the Anaphase- Promoting
FT                   Complex/Cyclosome (APC/C) which is a ubiquitin- protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06820g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21646"
FT                   /db_xref="GOA:C5DCY5"
FT                   /db_xref="InterPro:IPR024990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCY5"
FT                   /protein_id="CAR21646.1"
FT                   /translation="MPKIPSVFLQNSKHGEVWVFDTRIVEWRLGGKCLRKLEFGGEKVL
FT                   NAGFVDFESVKECLVVVLEDRAHVYYVGKGDFSIVSFPFSVSKAFFHVNGVLLERKLEE
FT                   ENAVGSKSPFAATKHRFITLSDPLNLFGSLVISSNLPEQQDSKATILHFPRAWDDHVSV
FT                   LHDCNAKTLYFYNCKILAPARASGSSSSSKSHNHESAPYPANSRKKSYASLAGDAATYG
FT                   KTSASNKRMLSNEHGSLASSSSSVPHATNAHPNNTATLSTELTNNLRKISIMNRRSASA
FT                   TMGIDLDQPSQTTGPSQSHPGVDYMKRSASATLDRMGSGSALDITPSNSSQFSQELFDH
FT                   AVLTKDVVLTRISQTPLSIDISPNTHVESCRFEDKEAIILHDPDSQWGKIWIFDLNSSM
FT                   TESMKFKAFNNTPIALTKIIDIKWSLIRNYCIHNSKLLPGYLMLLSSSGEEITLYNPFL
FT                   NLTSNPMLIPSREHERALYFSRENLVITSEKASPVNLAILPQIEAVKHCFTAIRYLCDS
FT                   FTYNYILLLWQVARSSVGEKQAACADFTALKLALLSLLQLERCPVNIKAHMEHIRQSPI
FT                   FDARFDGARFLPKIVMGMHLISEEYKLNLLQKQNVEMLEGILYLLTTLMKWPRLWKEFY
FT                   GANEKEDTSFEYKLSNRHFAHPLDEPPSILKSLYSVSDESTIPITPFITFSRLLEDGSS
FT                   VDHIITPRTNKILQLFESLDAIKFSQSNLLDIMNSLNIDSYELETYPLGVFAPLKRVLK
FT                   SVENHVSEVNTGSDFTLIDRPDLQKNQEVLKSVQCDTTQTRKPLQPLVSLGPKGRENSK
FT                   LQGCQPRSIRTIIDDILCLTENQPSDNLSGTNINEEVGEGQVLKRNASLIFSEDRRFFD
FT                   VVELLLYNIPHKLAVLINEKSYTRALKKKRLFSQILALRTFTSGIGWGAVAFSTEKPLA
FT                   TQKWPQPKMNLHCIFTDKTTVTVDPKECDPSLLSWGEFHGGVSSGLRISRKSTGITGSW
FT                   ITFTKPPELNAQHGGFLLGLGLNGHLKNLEEWHVYNYLSPKQTHTSIGLMLGMSASLRG
FT                   TMDLKLTKVLSVHIVALLPHGSSDLNVNYRVQTAGLIGVGLLYQNSQHRRMSDMLFAEV
FT                   SSFVSIDEEAVPDEGYRLAAGIALGLVNIGAGAKAAEAQFKKMAHAETYTSDEDDEDSE
FT                   FAEFRANNGNLDPKIINGLMNIVNSVHDTEESWMPANSQIGAVVALMLIYLKTNNRTVA
FT                   EKLAPSSEEINLKARPYTRPELYMYREWAHHMILWDHIASNTEWLFKGINIACALQVNT
FT                   DFLPIYYCIAGRALALGLKFASSGNSEARDNILALVDKLLPLYQCPIDARLDFQLTIKA
FT                   INVLLNVLLVSVSMIMSGTGDLAVFRRVKFLHETVSGKNSDLFRTPLRKRQQKRNHTED
FT                   EMSVDLTEEPEDGVQAEGNDLGEELEEEEANSTINEELESDDASDESRRYKDEENHFGK
FT                   FMATSLSLGFLFLGSGQYAFKVSKLENLAYLIMSVLPTYMCPYYLQETKHFWSMAVEYR
FT                   SLLVCDSRTGASLNKVPVDVTFKGSKSSNTFSTLKMVSPCLLPDVRLIRSIKILSPDYY
FT                   PVSLDFRSDEDRINFFNNGCVLYVPPREDDGNGWQQNQEAADKSCEVRQILKKKVMSLS
FT                   SPSASTSKSKCTDDILKHLGLANQESLEIENEVLKLKENQDPLLDENLMMSCQNQSKSY
FT                   HLELWRRRHKF"
     atgcctaaaa ttcctagtgt cttcttacaa aattctaagc acggcgaagt ctgggttttc        60
     gacacacgca tcgtagagtg gaggctgggg ggtaaatgcc tgcgtaagct cgagttcggt       120
     ggcgaaaagg tactcaatgc ggggtttgtg gacttcgagt ccgtcaaaga atgtctcgta       180
     gtggtgctcg aagaccgcgc ccatgtttat tacgtcggga aaggagattt tagcatcgtg       240
     agcttcccgt tctcagtgtc caaggcgttt ttccacgtca acggcgtgct attggaacgc       300
     aagctcgagg aagaaaatgc cgtcggttcc aaatctccgt ttgcagccac caagcaccga       360
     ttcatcacgt tgtcggaccc attgaacctt tttgggtctc tggtaatttc gtcgaacctg       420
     ccggaacagc aagattcgaa agccacgatc ctgcatttcc cccgcgcgtg ggacgaccac       480
     gtcagcgttc tgcatgactg caatgcgaag acgctgtatt tctacaactg caaaattctg       540
     gctccggcac gggcgtcggg gtcttcctcg agctccaagt cccacaacca cgagtctgcg       600
     ccttaccccg caaactcacg gaagaaaagc tacgcatctt tagcaggcga tgcggcgaca       660
     tacggcaaaa cgtcggcttc caacaagaga atgctgtcca atgagcatgg ttccctggcc       720
     tcttcctcgt cgtctgtacc gcatgccaca aacgctcatc caaacaacac tgcaactctt       780
     tccacggagc tcactaacaa cctgcgaaag atttcaatca tgaacaggcg ttcggcctcg       840
     gcaaccatgg gcatagatct tgaccagccc tctcaaacga caggcccatc acagagtcac       900
     cctggcgtag actacatgaa aaggagcgct tcagcaacgc tagaccgaat gggatctggt       960
     agcgcgctgg acattactcc ttctaacagc tctcagtttt cccaagaact ttttgatcac      1020
     gccgtgctca ctaaagatgt tgttctcacg agaatctctc aaaccccctt atccatcgat      1080
     atctcgccca acacacatgt ggagagttgt agatttgagg acaaggaagc catcatttta      1140
     catgatcctg attcccaatg gggaaagatc tggatatttg acttgaattc atcaatgacc      1200
     gaaagcatga agtttaaggc tttcaataac acacctattg cattgaccaa aatcattgat      1260
     atcaagtggt ccctgattcg caactattgc attcataatt ccaaattatt gcctggatac      1320
     ctcatgctcc tcagcagttc gggcgaagaa atcacgctat acaacccctt tttgaatctg      1380
     acatcaaacc ctatgctgat accttccagg gagcacgaaa gggctctgta tttctctcgg      1440
     gaaaaccttg tcataacaag cgagaaagcg tctccagtga atctagccat tcttccacag      1500
     attgaagccg tgaaacactg ctttactgcg atacgctacc tatgcgattc attcacctac      1560
     aactatattc ttcttctttg gcaagttgcg agaagtagcg taggcgaaaa gcaagctgct      1620
     tgtgcagact ttacggcatt gaaactcgca ctacttagtc tactgcagct ggaacgttgc      1680
     cctgtgaaca taaaagcgca tatggaacat atacgacaaa gtcccatttt cgacgctaga      1740
     ttcgatggag ctagattcct gcccaaaatc gtgatgggca tgcatctaat aagcgaagag      1800
     tataagctga acctattaca gaagcagaat gttgaaatgc tggaaggcat tctctatttg      1860
     ttaactactt tgatgaagtg gccacggctt tggaaggagt tttatggagc taacgaaaag      1920
     gaggatacat cttttgagta caaattatca aatcgccact ttgctcaccc cctcgatgag      1980
     ccgccatcga ttttgaagtc tttgtatagt gtttcagatg aaagcacaat tccaattaca      2040
     cctttcatca cattttcgcg gctcttagaa gacgggtctt ctgttgatca cattatcact      2100
     ccacgcacta acaaaatatt gcaactattt gagagtttag atgccatcaa gttttcacag      2160
     tcaaacctgc tggatattat gaactctttg aacatcgact catatgagct tgaaacctac      2220
     ccactgggag tttttgctcc tttgaaaaga gttttaaaga gcgttgagaa tcacgtcagt      2280
     gaagtaaaca cggggtctga ttttacgtta attgaccgcc ctgaccttca aaaaaatcag      2340
     gaagttctca aatcagtgca atgcgataca actcagaccc gaaaacctct tcaacctctt      2400
     gtcagtttag gcccgaaggg ccgcgaaaat agcaagctcc aggggtgtca accgagaagc      2460
     atcagaacta taattgacga cattctatgc ttgactgaaa accagccaag tgacaatctt      2520
     tcaggtacga atatcaacga agaagttgga gagggccaag tattaaaacg caatgcttcc      2580
     ttgatatttt ctgaggatcg taggtttttt gacgtcgtgg aacttctgct ctacaatata      2640
     cctcacaagt tggcagtgct cataaatgaa aagagctata caagggcact aaaaaagaag      2700
     cgactttttt cgcaaatact agctttaaga actttcacat ctgggattgg gtggggagcg      2760
     gtcgcatttt caactgaaaa gcccttggcg acgcaaaaat ggccacagcc aaagatgaat      2820
     ctccattgca tattcacaga taaaacaaca gtcaccgtag atcctaagga atgcgatcct      2880
     tccttgttgt catggggtga gtttcacgga ggtgtcagct cagggctccg tatttccagg      2940
     aaatcgacag gcataacagg cagttggatt actttcacca aaccaccaga actcaatgcg      3000
     cagcacggcg ggtttcttct agggctgggc ttaaatggac atctaaaaaa tttagaggaa      3060
     tggcatgtct acaactacct gagtcccaag cagacacaca caagtattgg gctaatgctt      3120
     gggatgagtg cgagcttaag aggcactatg gacctcaaac taaccaaagt tttgagcgta      3180
     catatagttg cccttttgcc ccatggatcc agtgatctta acgtgaacta tagagtacaa      3240
     acagctggat tgattggtgt gggccttctt taccaaaact cgcagcatag aagaatgagc      3300
     gacatgctat tcgcggaggt ttcctctttt gttagtatag atgaagaagc ggtaccggat      3360
     gagggatata ggcttgccgc aggaatagcg ttgggccttg ttaatattgg tgcaggcgcc      3420
     aaggcagctg aggcccaatt caaaaaaatg gctcatgctg aaacttatac aagcgacgaa      3480
     gacgacgagg acagcgagtt cgcggaattt agagctaaca acggtaacct tgatccaaag      3540
     attatcaacg gccttatgaa cattgttaat agcgtccatg acaccgagga gagttggatg      3600
     ccagcaaact ctcaaatcgg ggctgtagta gccttgatgc taatttactt gaagactaat      3660
     aatcgcactg ttgcggagaa actggcaccc agttcagaag aaataaacct gaaagcaaga      3720
     ccatatacaa ggcccgagct ttatatgtac cgtgaatggg cgcaccacat gatactctgg      3780
     gatcatatag caagcaacac agaatggctg ttcaaaggaa ttaatatcgc ttgcgcgctg      3840
     caggtcaata cggacttttt accaatctat tactgcattg cgggacgcgc tttggcccta      3900
     ggattgaagt tcgcctcgtc aggaaacagt gaggcccgcg acaatatcct cgcattggtc      3960
     gacaaactgc ttccattgta ccagtgccct atcgatgcga ggctggactt ccaattaaca      4020
     atcaaagcta taaatgttct attgaacgtg ctcctggttt cagtgagtat gataatgagt      4080
     ggaactggcg atctggctgt attcaggagg gtaaagtttc tgcatgaaac agttagcggc      4140
     aaaaactctg acctgtttcg cactccactt cgcaaaagac agcaaaagag gaaccacaca      4200
     gaggacgaga tgtcagtgga cctcacggaa gagccggaag atggtgttca agccgaagga      4260
     aatgacttag gcgaggaact ggaagaggaa gaagctaact caacgatcaa tgaagagctt      4320
     gaaagcgacg acgcgagcga cgaaagccgc cgctacaagg atgaggaaaa ccacttcgga      4380
     aagttcatgg ctacaagttt aagcttaggt ttcttgtttt tgggatccgg tcaatatgca      4440
     ttcaaagttt ctaagttgga aaacttagct tatctcatta tgtcagtact cccgacgtat      4500
     atgtgccctt actatcttca agagacaaag cacttctgga gcatggctgt tgaatacaga      4560
     agcttgctag tttgcgattc cagaactggg gctagcctta acaaagtccc tgttgacgtg      4620
     accttcaagg gttcgaaaag ctcgaacact ttttcgacac taaaaatggt ctctccttgt      4680
     ctcctgcctg acgtacggct catacgttcg ataaagattc tctcgcccga ttactacccc      4740
     gtttctttag actttagatc agacgaggat cgcatcaact tcttcaataa tggctgtgtt      4800
     ctttatgtgc cgccaagaga agacgatgga aatggctggc aacagaacca ggaggccgcc      4860
     gacaaaagtt gcgaggtcag gcaaattttg aagaaaaagg taatgtcctt gtcttcacca      4920
     tcagcgtcta catcaaaaag taaatgcact gacgatatac taaaacattt gggacttgca      4980
     aatcaagaat cgttagaaat tgaaaatgag gtattgaaat tgaaagaaaa tcaagacccc      5040
     cttcttgatg agaacctgat gatgtcttgt caaaaccaaa gcaaaagtta ccacctcgaa      5100
     ctttggcgta ggcgccacaa attctga                                          5127
//

If you have problems or comments...

PBIL Back to PBIL home page