(data stored in SCRATCH zone)

EMBL: CU928166.PE286

CU928166.PE286       Location/Qualifiers
FT   CDS_pept        complement(561932..562537)
FT                   /locus_tag="KLTH0B06952g"
FT                   /old_locus_tag="KLTH-ORF15002"
FT                   /product="KLTH0B06952p"
FT                   /note="similar to uniprot|Q02774 Saccharomyces cerevisiae
FT                   YDL212W SHR3 Endoplasmic reticulum packaging chaperone
FT                   required for incorporation of amino acid permeases into
FT                   COPII coated vesicles for transport to the cell surface"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06952g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21651"
FT                   /db_xref="GOA:C5DCZ0"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ0"
FT                   /protein_id="CAR21651.1"
FT                   /translation="MKLTYKDICTIGTGLILIGTSFIMGVFFANQTYDYHILFNTDLKP
FT                   SHFENSLRHYQTLYYTAPPVLYALGAVVSLGLIGCLIKVYKPNPDLKIFEYATLVMYVI
FT                   GVCMFITNIKTGIESSVSSNWGEVTENQGLAVIASSNVILLVIFIGVLVLQAGLWYSHW
FT                   EYQQRLEQFYAEEAKTAAAVTPTGETKPAKKTEAKKQK"
     atgaagctca cttacaagga catttgcacc atcggtacgg ggctcatctt gatcggaacc        60
     tccttcatca tgggcgtttt cttcgccaac cagacctacg actaccacat cctgttcaac       120
     accgatctga agccatccca cttcgagaac agtctgcgcc actaccagac cctctactac       180
     accgcgcctc ccgttctgta cgcgctgggc gctgtcgtta gtctcggtct gattggatgt       240
     ctcattaagg tttacaagcc caacccagac ctgaagatct ttgagtacgc caccctggtc       300
     atgtacgtca ttggcgtgtg catgttcatc accaatatca agaccggtat cgaatcttct       360
     gtgtccagca actggggcga ggtcaccgag aaccaaggtc tcgctgtgat tgcctcctcc       420
     aatgtcatct tgctggtgat ctttatcggc gtactagtgc tccaggccgg tttgtggtac       480
     tctcactggg agtaccagca aaggctggaa cagttctacg ccgaggaggc caagactgct       540
     gctgctgtca cgcccaccgg cgagaccaag cctgccaaga agactgaggc aaagaagcag       600
     aagtaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page