(data stored in ACNUC8465 zone)

EMBL: CU928166.PE288

CU928166.PE288       Location/Qualifiers
FT   CDS_pept        565363..566142
FT                   /locus_tag="KLTH0B06996g"
FT                   /old_locus_tag="KLTH-ORF14991"
FT                   /product="KLTH0B06996p"
FT                   /note="weakly similar to uniprot|P53879 Saccharomyces
FT                   cerevisiae YNL180C RHO5 Non-essential small GTPase of the
FT                   Rho/Rac subfamily of Ras-like proteins likely involved in
FT                   protein kinase C (Pkc1p)-dependent signal transduction
FT                   pathway that controls cell integrity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B06996g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21653"
FT                   /db_xref="GOA:C5DCZ2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ2"
FT                   /protein_id="CAR21653.1"
FT                   /translation="MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTTTIA
FT                   LNDGKSIEPQVFRLNLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFMNVKDKWF
FT                   PEIRHNTNYDNLELFRVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRAEIDQCI
FT                   SQCGFMGYVECSAATQVGVAEVFERAVQCVIIEPERLLNQSKQRESTIDHPTNNQSNTA
FT                   ASSGAGAGTAGSSSNWNAPGSNPMKKRKKKSQKCTIL"
     atgaggtctg tcaagtgcgt gattgtgggc gacggtgcag tgggtaagac ctcgctgctc        60
     atctcgtata ccaccaacac cttcccccag gactacatcc ccacggtctt cgacaactac       120
     accaccacga ttgccctgaa tgacggcaag tccatcgagc cacaggtgtt caggctgaac       180
     ctgtgggata ctgccggcca ggaggagtac gaccgtctga gacctctttc ctacccccaa       240
     acagacatct ttctgctgtg cttcagcatc aacgagccca actccttcat gaatgtcaag       300
     gacaaatggt tcccggaaat caggcataac accaactacg acaacctgga gctgttccgt       360
     gtttgcggga agtaccccat cctgctagtc gggacaaagg ctgacctccg cgacgacgag       420
     cacgagcaag accgcctcgc agaggtgaac tcggactttg tttccagagc tgagattgac       480
     cagtgcatct cgcagtgcgg tttcatgggc tacgtcgagt gttccgcggc cacccaggtt       540
     ggtgtcgcag aggtgttcga gcgcgctgtc cagtgcgtca taatcgagcc cgagaggctt       600
     ttgaaccagt ccaagcagcg cgagagcacc attgaccacc caaccaataa ccagagcaac       660
     accgcggcga gctcaggggc cggcgctggt accgctggct catcaagcaa ttggaacgcc       720
     cccggctcca acccaatgaa gaagcggaag aagaagagcc aaaaatgtac tatattgtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page