(data stored in ACNUC8465 zone)

EMBL: CU928166.PE289

CU928166.PE289       Location/Qualifiers
FT   CDS_pept        complement(566364..567581)
FT                   /locus_tag="KLTH0B07018g"
FT                   /old_locus_tag="KLTH-ORF14989"
FT                   /product="KLTH0B07018p"
FT                   /note="similar to uniprot|P53878 Saccharomyces cerevisiae
FT                   YNL181W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07018g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21654"
FT                   /db_xref="GOA:C5DCZ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ3"
FT                   /protein_id="CAR21654.1"
FT                   /translation="MPVNIITAGLIEGFDTLPFYRQIKAIAPYAAGVIAVKLWSRGAKN
FT                   TWERNLNGKVYILTGATTQGMGTSVALEMAQKGAQLIILTRVVDEWSTEWVEDLRQRTG
FT                   NELIYLEQCDLSDLYEVRKFATKWLDNSPPRRLDGVVVMSGNLQPAGLVPGWSHGTRKS
FT                   SKDGLELQIATNFAGVFHLLNLLTPSFKAQPPDRDVRIIVTTCMLQAIGEVQVDDPLWE
FT                   DVKYDRPLKFFGSSKLQLSLCMLELQRRILSSTTKDGRSGKNVTVVLAQPGVMRSTSLR
FT                   QLISNGSVFVLVFIYSILLYPLLWLLTKSGYRGAQSILYALTTPELEEINWVDEQVKYV
FT                   VNCSMAKFARKEFADKELQEKLYETTEAKILEVEKKMAVKRNLSKKNTKNDAKGRTKDA
FT                   KGNRKD"
     atgcctgtga atattattac ggctgggctt attgaaggtt tcgacactct tccgttttat        60
     cggcaaatta aagcaattgc tccatatgca gccggagtaa tagcagtgaa gctgtggtct       120
     agaggagcga aaaacacttg ggagaggaat ctgaatggta aggtatatat tctgacaggg       180
     gctactacgc aaggaatggg taccagtgtt gcgctcgaaa tggctcaaaa aggtgcgcag       240
     ctaatcattc tgacacgggt ggtcgacgaa tggtcaaccg aatgggttga agacctgcgc       300
     caacgtacgg ggaatgagct gatctatctg gagcagtgcg acctatctga tttatacgag       360
     gttcgcaaat tcgcaacgaa gtggctggac aactcgcctc ccaggcgcct ggacggtgtt       420
     gtagtcatgt ctggaaatct gcagcccgcc ggattggtgc caggctggtc acacggaaca       480
     agaaaatcgt caaaagacgg cttggagcta caaattgcaa caaacttcgc tggcgttttc       540
     catctcttga acctgctgac tccaagcttc aaagcgcagc ctccggacag ggacgtgcgc       600
     atcattgtca cgacgtgcat gttgcaagct attggagagg tccaggtcga tgatcctctg       660
     tgggaagatg ttaaatacga tcgtccgctc aagttctttg gcagctccaa acttcagctg       720
     agtttatgca tgctggaact gcagagacgc atcttgagtt ccactactaa ggacggaaga       780
     tcaggcaaga atgtgactgt tgtgctggcg cagccgggtg ttatgagatc tactagtttg       840
     aggcagctga ttagtaacgg ttctgtcttt gttctggtgt tcatttactc aatactactg       900
     tatcccctgt tatggctact gactaagagc ggataccgcg gcgcccaatc tatattgtat       960
     gcgctgacga ctcctgagct ggaggagatc aattgggttg acgagcaggt gaaatacgtg      1020
     gtaaactgtt caatggctaa atttgcgaga aaagagttcg cagacaagga gcttcaggaa      1080
     aagctgtatg aaactacgga ggccaagata ctagaagtag aaaagaagat ggcagtcaag      1140
     cgcaatttga gtaaaaaaaa taccaagaat gatgctaagg gcagaaccaa ggatgctaaa      1200
     ggcaaccgca aggattga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page