(data stored in ACNUC8465 zone)

EMBL: CU928166.PE290

CU928166.PE290       Location/Qualifiers
FT   CDS_pept        567756..569276
FT                   /locus_tag="KLTH0B07040g"
FT                   /old_locus_tag="KLTH-ORF14985"
FT                   /product="KLTH0B07040p"
FT                   /note="similar to uniprot|P53877 Saccharomyces cerevisiae
FT                   YNL182C IPI3 Protein required for cell viability
FT                   computational analysis of large-scale protein- protein
FT                   interaction data suggests a possible role in assembly of
FT                   the ribosomal large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07040g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21655"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ4"
FT                   /protein_id="CAR21655.1"
FT                   /translation="MDEQLIFSTNTTCTVGSLHSPNQTNLKQCSNEFRNGSCLVGSKYL
FT                   LVAQARKALINVYRIEGSGKRESVEQRLPLPETVNCLEVVENNAEQNGNSQLPYLLLAS
FT                   TSSGKLYVWEMASGNLLTVKAMAHYQAITKIRSIIQGKYVITSGADARIMIWQTVDLVS
FT                   QQDPKPLFTLHDHTLAVTDFEVSNAHSSQLSGKLFTVSHDMTMRCYDLNMDVFDKPQLL
FT                   TTFTFPFPLECITLDPADRACYVGGAQGVYALPFYYPIGDRKVANLLSSDSSNILSCVE
FT                   QQPGDKNADLFTMGKVALAKITNAQTSQLACSLEGSLLVVGDSLGKCTVMDVYSKQPVK
FT                   EIQAIVANETAGEVTSIILNPVNVDNSNSLLGDGKTQSGFKIPNLQKNVFAREGLHDIL
FT                   FQIEDLQDSKVAPLDDFEAYLDQVAAEEGTFAQLGNVVSTVKVMSESEGANRNPENPDT
FT                   AQRPADDGELLTMKATVGQLTGAYKELREMYDKLFQEHESLRSTLGEN"
     atggacgaac agctcatctt cagtacgaat accacctgca cggtgggctc cttacattcg        60
     cccaaccaaa cgaatttaaa gcagtgttcg aatgagttcc gcaacggatc gtgtctggtg       120
     ggcagcaaat acctattggt tgcccaagca cgcaaggctc taatcaacgt gtacagaatc       180
     gaaggctctg gaaagagaga atctgtagaa cagagactgc cgctgccgga gaccgtcaac       240
     tgcctggaag ttgttgagaa caatgcagag cagaatggta actcacagct gccatatctg       300
     ttgttagcgt cgacttcctc tggtaaactc tacgtctggg aaatggcttc aggaaatctg       360
     ctcacagtta aagctatggc gcactaccaa gccatcacaa aaattcgttc tatcattcag       420
     ggaaaatacg taatcacgtc tggtgctgat gcgcgcataa tgatatggca aactgtggat       480
     ttagtttccc agcaggaccc aaaaccactt tttactttgc atgatcacac gctggctgta       540
     acagactttg aggtttcaaa cgcacactcg tcccaactat ccggcaagct tttcacagtc       600
     tcgcatgata tgactatgcg ctgttacgat ctgaatatgg acgtgtttga caaaccgcag       660
     ctactaacca ctttcacctt ccccttccct ctggagtgca taactttgga ccccgctgac       720
     agggcatgct acgtgggcgg cgcacaaggc gtatacgcat tgccatttta ttacccaatc       780
     ggagaccgta aagttgccaa tctcctcagc tctgactcaa gcaacatcct ttcttgcgtt       840
     gaacagcaac cgggcgataa aaatgccgac ttgttcacaa tgggaaaggt tgcactagct       900
     aagattacga acgctcaaac ttctcagttg gcgtgctctc tcgagggaag tctcctagtc       960
     gttggtgact cgctaggaaa gtgcaccgta atggatgttt actctaagca accagtcaag      1020
     gagatacaag cgatagttgc caacgagacc gcgggagaag taacgagcat catactcaat      1080
     cctgtgaatg tcgacaactc aaatagcctt ttgggtgacg gcaagacgca gtcgggattc      1140
     aaaataccca acctacagaa aaacgtattt gctcgtgagg gtttgcacga catccttttc      1200
     cagatcgagg acctgcagga cagtaaagtg gcacccctgg atgacttcga agcgtacctt      1260
     gatcaagttg ctgccgagga gggtacgttt gcccagctcg gcaacgttgt ttcgacagtc      1320
     aaagtgatgt cggaaagcga aggagcaaac agaaatcctg agaacccgga cactgcgcaa      1380
     cgcccagctg acgatgggga gctattaact atgaaggcaa ctgtcggcca gctcactgga      1440
     gcttacaagg agctgcgaga aatgtatgac aagctcttcc aagaacatga aagtttgcgg      1500
     agtaccttag gggaaaacta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page