(data stored in SCRATCH zone)

EMBL: CU928166.PE293

CU928166.PE293       Location/Qualifiers
FT   CDS_pept        571005..573260
FT                   /locus_tag="KLTH0B07106g"
FT                   /old_locus_tag="KLTH-ORF14978"
FT                   /product="KLTH0B07106p"
FT                   /note="similar to uniprot|P22211 Saccharomyces cerevisiae
FT                   YNL183C NPR1 Protein kinase that stabilizes several plasma
FT                   membrane amino acid transporters by antagonizing their
FT                   ubiquitin-mediated degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07106g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21658"
FT                   /db_xref="GOA:C5DCZ7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ7"
FT                   /protein_id="CAR21658.1"
FT                   /translation="MSSLTKLLQEKRKNEGGLSSGLAQTRSQMSSAGTAAGTSGGTGSA
FT                   ASEELSSSVGSNVLMNQEAFSSSFFNANSAHTAALSESYKDRDRPAPLTIESRGGNARL
FT                   SSQGFQPGSQPGPQSGPRPVPSLSSSIPYSVPNSNANGSSGSNAAGGAGSGGFHSSNGS
FT                   GVSSASSSWLESPGVMPSNVSAIDSNVISSPKVDTVEPRFVISKQKFQKASMDNAANSY
FT                   SNAQNGSISRSSSISSQLGNLFFTKNGKELSSSQNSQSRDIPTNSAQSAAYGSSIPKPM
FT                   RARRSSLYGSSRQPSNSYQDTFIGSPSSLHEQPPNQYMPRSRHSSIADLKRFFKKGQSV
FT                   NMSVSPGTPPVSSGGNISSHNSNASSFGPGSYSSNNGDTIYTSSASSTLPYSKRYTKTG
FT                   EVLGAGAGGSVRLVKRLQDNKVFAVKEFRTKFESEAKRDYVKKITSEYCIGTTLRHPNI
FT                   IETVEIVYDNNRILQVMEYCDYDLFAIVMSNKMSYEEICCCFKQILTGVQYLHSMGLAH
FT                   RDLKLDNCVINKQGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLAPEVCIFSKYD
FT                   PRPVDVWSIAIIFACMVLKKFPWKIPKLKDNSFKLFCSGRNCDSLSALVTRTPDPPSYD
FT                   SATNTDENDKPKAEAPVSNNPANPENPNIGPQRLLHSLPEESQHIIGRMVELAPACRVS
FT                   IDDIMKDPWVESIDVCEVVEEGYSTKVVSGVDHKHTQVDQSEAHIAGLEKKKKKQNR"
     atgtcttccc tgaccaagtt actgcaggaa aagcgaaaaa atgaaggagg actgtccagc        60
     ggtctggcgc aaacgcggtc tcaaatgtcg agcgccggaa cggcagccgg aacgagtggc       120
     ggcacaggaa gcgcggcgag cgaggagctc tcgtcgtcgg tgggctccaa cgttttgatg       180
     aaccaggaag ccttctcctc gagctttttc aacgccaact cggcgcacac agcggctctg       240
     agcgagagct acaaagatag agacaggccc gcacccctta cgatcgagtc acgtggcggt       300
     aacgcgcggc tctcgtcgca gggcttccag ccggggtcgc agcctggccc gcaatcgggc       360
     ccacggcccg ttccctccct gtcctcaagt ataccctact cggtgcccaa ctcgaacgcg       420
     aatggtagca gtggcagcaa cgcggcaggc ggcgcaggca gcggtggatt ccactcaagc       480
     aacggaagcg gagtttcgtc agcatcgtcg tcgtggctcg aatcccctgg tgtgatgcca       540
     agcaacgtct ctgcaattga ctccaacgta atctcttcac ctaaggtcga cacagtcgag       600
     ccacggtttg tcatttccaa gcaaaagttc caaaaggctt ccatggacaa tgctgcgaac       660
     tcctattcca acgctcagaa cggctcgata tcccggtcaa gctcgatctc gtctcagttg       720
     ggtaacctct tcttcacgaa aaacggcaag gagttgtctt cgtctcagaa ctcgcagtcc       780
     cgagacatcc ctaccaactc tgctcagtca gctgcatatg gttcatccat ccccaagccc       840
     atgcgcgcca ggcgtagctc gctctacggc agttcgagac agccttcgaa ttcctaccaa       900
     gatactttca ttggatctcc atcctctttg cacgagcaac cccctaacca gtacatgccc       960
     aggtctcgcc attcgtcgat tgcggacctg aaaaggtttt tcaaaaaggg ccaaagcgtg      1020
     aacatgagcg tttcccctgg tactccaccg gtttcgtccg gggggaacat cagttctcac      1080
     aattcaaatg cctcgtcctt tggccccggc tcctacagca gcaacaacgg tgacacgata      1140
     tataccagct ctgcctcttc aactttgcct tattccaaaa ggtacaccaa gacaggcgaa      1200
     gtattaggcg cgggtgcagg cggctctgtt agattagtca agaggctcca ggacaacaag      1260
     gttttcgctg tcaaagagtt tagaaccaag ttcgagagcg aagccaaacg agactatgtg      1320
     aagaagatca cctcggagta ttgcataggt accacgttac gccaccccaa catcatcgaa      1380
     actgtggaaa ttgtctacga taacaacagg attttgcaag tcatggagta ttgtgattat      1440
     gatttgtttg caatcgtgat gagcaacaag atgtcctacg aggagatttg ctgttgtttc      1500
     aagcaaatcc tcacaggtgt gcaatatctg cattcgatgg ggctcgcgca tcgtgaccta      1560
     aaactggata actgcgttat caacaagcaa ggtgttgtga agctcatcga cttcggggct      1620
     gcggccgtgt tttcataccc cttttctaag acacttgtgg agtcttccgg cattgtggga      1680
     agtgacccat acttggctcc agaagtttgc atcttttcca agtacgaccc tcgtccagtg      1740
     gatgtgtggt cgattgcaat aatctttgcc tgcatggtgc tgaaaaagtt tccttggaag      1800
     atccctaaac ttaaggacaa ctccttcaaa ctattctgct cgggccggaa ctgtgattcc      1860
     ttgagtgctt tagtaactcg gacaccggac cccccatctt atgacagcgc caccaacact      1920
     gatgagaatg acaagcctaa ggctgaagcc ccagtctcca ataacccagc gaacccagaa      1980
     aatcctaata ttggacctca gagactttta cactccttac ccgaagaatc acagcatatc      2040
     atcgggcgca tggttgagct cgcaccagcg tgcagagtca gcattgacga cattatgaaa      2100
     gatccttggg tggaaagcat tgacgtgtgt gaggtcgttg aagaagggta ctccactaag      2160
     gtggtatctg gtgtggatca taagcacacc caggtggacc aaagtgaagc ccatattgca      2220
     gggctagaga aaaagaagaa aaagcagaac agataa                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page