(data stored in SCRATCH zone)

EMBL: CU928166.PE294

CU928166.PE294       Location/Qualifiers
FT   CDS_pept        573530..574060
FT                   /locus_tag="KLTH0B07128g"
FT                   /old_locus_tag="KLTH-ORF14974"
FT                   /product="KLTH0B07128p"
FT                   /note="highly similar to uniprot|P53875 Saccharomyces
FT                   cerevisiae YNL185C MRPL19 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07128g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21659"
FT                   /db_xref="GOA:C5DCZ8"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ8"
FT                   /protein_id="CAR21659.1"
FT                   /translation="MPVNIKKNFKRLGYRIPIDLKKHRAKIMSKPLKNIIVKLIVGAGQ
FT                   AAPSPPVGPALGSKGIKAIDFCKEFNARTASYQPGTPVPVLITIKPDRSFAFEMKSPPT
FT                   GFLLLKSLGKDKGMGQPDVKSPAGTLGELSLKHIYEIAKIKKSDGRHASLGMESIVKSV
FT                   VGVAKSMGINVVP"
     atgcctgtca atattaagaa aaattttaaa agactaggct atcgaatacc aatcgattta        60
     aagaagcatc gagcaaagat aatgtcaaaa cctctcaaaa atattatcgt gaagttgatt       120
     gttggcgcgg gacaggcagc tccatcgccg cctgtcggtc cagcgttggg ttctaagggt       180
     ataaaagcca ttgacttctg taaagaattc aatgcccgca cggcgtctta ccaaccgggg       240
     acccccgttc cagtgctgat cacaataaag cctgaccgct cgtttgcgtt tgagatgaag       300
     tcacccccaa ccggattcct cctcctgaaa agcttaggaa aagataaggg catgggccag       360
     cctgatgtga agagccccgc aggaacacta ggagaactgt ctctgaagca catctatgaa       420
     atcgcaaaga tcaaaaaaag tgatgggaga catgcatcgc ttgggatgga aagcattgtt       480
     aagtccgtgg ttggggtcgc gaagagcatg ggtatcaacg tggtgccata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page