(data stored in SCRATCH zone)

EMBL: CU928166.PE295

CU928166.PE295       Location/Qualifiers
FT   CDS_pept        complement(574195..576465)
FT                   /locus_tag="KLTH0B07150g"
FT                   /old_locus_tag="KLTH-ORF14973"
FT                   /product="KLTH0B07150p"
FT                   /note="some similarities with uniprot|P53874 Saccharomyces
FT                   cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
FT                   deubiquitinates ubiquitin-protein moieties may regulate
FT                   silencing by acting on Sir4p involved in
FT                   posttranscriptionally regulating Gap1p and possibly other
FT                   transporters primarily located in the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07150g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21660"
FT                   /db_xref="GOA:C5DCZ9"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCZ9"
FT                   /protein_id="CAR21660.1"
FT                   /translation="MQEHDAVKPLVERLLAQPLQFKPATAPDSVEGKPVSCVVIGSSRP
FT                   AAHHPTRRDGTNADASGRTQGDGRKANGTSGNANGRRPVPKNFSEALQMYTARKQIPSD
FT                   VELSDGKYQSSSDGEGAGEDVVDAPDAAGAQSESGESSDSAAEEFHEAHEYVEDGSSDP
FT                   GSGADAVASTGEDLGEDLGEDLGEDLGEDLGEDLGEDVGEGLGEDLGEDPEEGAKENAG
FT                   NSKPETDADEREASLGSVSDQDDQDEEDADFQDDGTEDSELEGPDGNITDSEKAGLMRE
FT                   AQEYAEMASLADARKKTEPAGEDNGNAEEESAHEENEEELKHKQPSSKRASPTPPTVLS
FT                   DMDRFYQFNEKANDRGANNSTRILKNWGPQLSTMKPKGLLNHGVTCYTNAAVQALIHIP
FT                   AIQHYLFDVLRGEYKSTISPNSVTQVLAETSKRMWSTDASKNQFINPKKLIGRLEDINC
FT                   MMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTESILYDIFGGMLRQEVTCKSCGEVSK
FT                   TEQPIYDISLHLKGKKNSDSADTAKNSSDFEEEPQRRFSIEKSIRDFFNPELIKVDKAN
FT                   KEGYVCEKCHKTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTE
FT                   FCENSKTTLPVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQML
FT                   KEPGAYYLVYTRLTPRSVPLPQGPSVSSSSAAAATNRAEGTPKSSSKRKKSKNKNKKRC
FT                   YNK"
     atgcaagaac acgacgcggt caagccgctg gtggagagac tacttgctca gccgttgcag        60
     tttaagcccg ctacggcgcc tgatagcgtc gaaggaaaac ccgtttcgtg cgtggtgatc       120
     ggatcttcgc gcccagcggc gcatcatcca actaggcgcg atggcaccaa cgccgacgcg       180
     tctggccgca cgcagggcga cggaagaaag gcgaacggga cgtcgggcaa cgccaacggc       240
     agaagaccag tgcccaagaa cttttcggag gcactgcaga tgtacacggc gcggaaacaa       300
     atccctagcg acgtggagct gagcgacggg aagtaccaga gctcgagcga cggcgaggga       360
     gcgggcgaag atgttgtcga cgcccctgac gcggccggtg cacagagcga gtctggcgag       420
     tctagcgact ccgccgcgga ggaattccac gaagcacacg agtatgtcga ggacgggtct       480
     tctgaccccg gaagtggcgc cgacgcggtg gcgagcacag gcgaagatct aggggaagac       540
     cttggtgagg accttggtga ggatctcggt gaggaccttg gcgaggacct tggtgaggat       600
     gtgggagaag gcctgggaga ggatctggga gaggaccctg aagagggagc taaagaaaat       660
     gccggtaact cgaagccaga aacagatgcc gatgagcgtg aggcatcgct gggcagcgtc       720
     tccgaccaag atgaccagga cgaagaagat gctgatttcc aagacgatgg caccgaggac       780
     tcagagttgg agggccccga cggcaacatc acagatagcg agaaagcggg gctgatgcgt       840
     gaagctcaag agtacgccga gatggccagc cttgccgatg ctcgcaaaaa gaccgagcca       900
     gccggcgagg acaacggcaa cgctgaggag gagagtgccc acgaagagaa tgaagaggag       960
     ctaaagcaca agcagccttc cagcaagcgc gcctccccca ctcctccaac tgtcctttca      1020
     gacatggatc gcttctatca gttcaatgag aaggcaaacg atcgtggcgc caacaactct      1080
     acacggattc tgaaaaactg ggggcctcag ctttccacca tgaaaccaaa ggggctgctc      1140
     aaccacgggg tcacctgtta caccaacgca gctgtgcagg ctttgatcca tattccggcc      1200
     attcagcact acctgtttga tgttttgcgt ggagagtaca aatctaccat atcaccaaat      1260
     tctgtgaccc aggtgcttgc ggagacatca aaacgtatgt ggtctacaga cgcttccaag      1320
     aaccagttta tcaacccaaa gaagctaatc gggagactgg aggatatcaa ctgcatgatg      1380
     agtgaatggc aacaagaaga ctcgcatgag tatttcatgt ctctaatctc gaggctccaa      1440
     gaggacagcg ttccacgcgg ccacaagcta acagaaagta ttctttacga cattttcggc      1500
     ggtatgctga ggcaggaggt tacctgtaaa agctgtggcg aagtgtccaa aacagaacaa      1560
     ccaatatacg acatctcctt acatctgaag ggcaagaaaa acagcgactc cgccgatacc      1620
     gctaagaata gctcagactt tgaagaggaa ccacaacgcc gcttctccat tgaaaagtca      1680
     attagagatt ttttcaatcc ggagctcatc aaagttgaca aggctaataa agaggggtac      1740
     gtgtgcgaaa agtgccacaa gaccactaac gcttcgaaac ataattttat cttgagagcc      1800
     ccggaaactc tactagtgca cctgaagaaa ttccgcttca atggaacatc gtcttccaag      1860
     ttgaagcagg cagtttccta ccctatgttc ctggacgtca ctgagttctg cgaaaattct      1920
     aagactacct tgccagtgaa atatcaacta ataagcgttg ttgttcacga gggccgctcc      1980
     ttgacctccg gccattatat tgctcactgc aagcagcctg acggctcttg gtcgacgtat      2040
     gatgacgagt acatcaacaa gatctccgaa aggcagatgc tgaaggaacc cggcgcctat      2100
     tatctggtat acacgcgttt gacacctaga agtgtacctc ttccccaggg cccaagcgtt      2160
     tcgtcatcca gtgcagctgc agctaccaac agagcagaag gcactcctaa gagctcctct      2220
     aagagaaaga agtccaaaaa caaaaacaaa aagagatgct acaacaaata a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page