(data stored in SCRATCH zone)

EMBL: CU928166.PE297

CU928166.PE297       Location/Qualifiers
FT   CDS_pept        582064..583302
FT                   /locus_tag="KLTH0B07194g"
FT                   /old_locus_tag="KLTH-ORF14958"
FT                   /product="KLTH0B07194p"
FT                   /note="weakly similar to uniprot|Q12468 Saccharomyces
FT                   cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)
FT                   COP9 signalosome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07194g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21662"
FT                   /db_xref="GOA:C5DD01"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR037740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD01"
FT                   /protein_id="CAR21662.1"
FT                   /translation="MRYSLETCRDLRARAHLVSQQLKDIEEGHGSMILGEREDCIDQPK
FT                   SLGDLIRKQVGVDVREESEQKHNSRHFKRVMLSNMASYKILQHALKGGDVEIMGMLVGS
FT                   TDRDSIIVFDCYPLPVEGTETRVNAQLESYEYMVQYMNEVYDSCSHPKNIVGWYHSHPG
FT                   YGCWLSGIDVQTQELNQTFQDPYIAVVVDPKKSAEDKRLSIGAFRTLNEDEIPENVDQY
FT                   GDSRYGHHSHKYYELEVKIFTSIFDTTLEQLQLRFDISASETPESSMVLEQLLESVRNW
FT                   NNFRKLTNPNQFLVQNSRQSDFSVQDHEVDMGAEFSSFSRRSSRASSVTSSKDESTGSD
FT                   VDMISNAIVGDYSTESSLPPASLAQPGMVTSEVEVPQVRSFEREYYLYKTNLSLIKLKE
FT                   YERLRYFKDTFTL"
     atgcggtaca gccttgaaac gtgcagggat cttagggcaa gggcacacct cgtctctcaa        60
     cagctcaaag atatcgaaga gggccatggc tccatgatac tcggtgagag ggaggactgc       120
     attgatcagc caaagtccct tggagacttg attcggaaac aagttggagt cgatgttaga       180
     gaggaatcgg agcaaaagca taactcaagg cacttcaaaa gggtgatgct atcgaacatg       240
     gcaagttata agatcctgca acatgctctc aagggcgggg acgtggagat tatgggaatg       300
     ttagtgggca gcactgacag agattcgata atagtttttg attgctaccc tctcccagtt       360
     gaagggaccg aaacgcgtgt caacgctcag cttgagtcat atgagtatat ggtgcagtac       420
     atgaacgaag tttatgactc gtgttcccac ccgaaaaaca tagttgggtg gtatcactcg       480
     catccaggat atgggtgctg gcttagtggt atcgacgtcc aaactcaaga gctcaatcaa       540
     actttccaag acccgtacat tgcggtagta gtggacccca aaaagagcgc tgaagacaag       600
     cgcctctcaa ttggagcttt cagaaccctg aatgaagatg aaattcccga aaacgttgac       660
     cagtacgggg acagccgcta cggccaccac tcccataagt attacgaact cgaagttaag       720
     atattcacga gtatatttga cacgacctta gaacagctac aattgcgctt tgatatatca       780
     gcttctgaaa ctcctgaaag cagtatggtg ctggagcaac tacttgaaag tgttcggaat       840
     tggaacaact tcagaaagct aacaaatccc aaccagtttc tagttcaaaa ctcaagacag       900
     tcggattttt ctgtccaaga ccatgaagtt gacatgggcg ctgagttttc atctttttca       960
     aggcgtagta gtcgagcaag ctccgtcacg agttctaaag acgaaagcac tggaagtgac      1020
     gtcgatatga ttagcaatgc catagttggc gattacagta ccgaaagcag cctgcctcct      1080
     gcgtcgttag cacaacctgg gatggtcacg agcgaggttg aggtacctca agttagaagc      1140
     tttgaacgcg agtattactt gtacaaaacg aacttaagct taatcaaatt gaaggaatat      1200
     gaacgccttc gatatttcaa ggacactttc actctataa                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page